DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and Ube2e3

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001343324.1 Gene:Ube2e3 / 22193 MGIID:107412 Length:207 Species:Mus musculus


Alignment Length:216 Identity:97/216 - (44%)
Similarity:131/216 - (60%) Gaps:19/216 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSDQVNSQTEMETEARARAEVE----VEVEPEVLSRASVASSVEETAPSTSH-----SASGKST 56
            ||||:..|..|..:.:...::.:    ...|||         ..||..||.:.     ..|.|:|
Mouse     1 MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPE---------EQEERKPSATQQKKNTKLSSKTT 56

  Fly    57 EAPLTGCVVRIKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASY 121
             |.|:....||:.||.:|..:|||||:|.....::..|.:.:.||.|||||||.|.|||.|.:.|
Mouse    57 -AKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDY 120

  Fly   122 PFRAPRIRFTTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIAD 186
            ||:.|::.|.|||||||::|:|.||||:|.:.|||.:.::||||||..|:::|||.||||..||.
Mouse   121 PFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIAT 185

  Fly   187 QYKTNRREHDKIARHWTKLFA 207
            ||.|||.|||:|||.|||.:|
Mouse   186 QYLTNRAEHDRIARQWTKRYA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 79/142 (56%)
UQ_con 66..203 CDD:278603 75/136 (55%)
Ube2e3NP_001343324.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 18/71 (25%)
UQ_con 65..202 CDD:395127 75/136 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S139
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.