DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and Ube2e2

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_017171445.1 Gene:Ube2e2 / 218793 MGIID:2384997 Length:239 Species:Mus musculus


Alignment Length:221 Identity:92/221 - (41%)
Similarity:123/221 - (55%) Gaps:28/221 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TEMETEARARAEVEVEVEPEVL-------SRASVASSV--EETAPSTSHSASGKSTEAPLTGCVV 65
            ::|.|||:     .|:..|...       .|.||....  |:..|..........|.|.|:....
Mouse    23 SKMSTEAQ-----RVDDSPSTSGGSSDGDQRESVQQEPDREQVQPKKKEGKISSKTAAKLSTSAK 82

  Fly    66 RIKSELQDIRKNPPPNC--------------TADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIR 116
            ||:.||.:|..:|||||              :|.....::..|.:.:.||.|||||||.|.|||.
Mouse    83 RIQKELAEITLDPPPNCRHMFYDSKWVPEALSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDIT 147

  Fly   117 FPASYPFRAPRIRFTTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLV 181
            |...|||:.|::.|.|||||||::|:|.||||:|.:.|||.:.::||||||..|:::|||.||||
Mouse   148 FSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLV 212

  Fly   182 MCIADQYKTNRREHDKIARHWTKLFA 207
            ..||.||.|||.|||::||.|||.:|
Mouse   213 GSIATQYMTNRAEHDRMARQWTKRYA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 78/156 (50%)
UQ_con 66..203 CDD:278603 74/150 (49%)
Ube2e2XP_017171445.1 UQ_con 83..234 CDD:365926 74/150 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.