DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and Ube2d1

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_006513541.1 Gene:Ube2d1 / 216080 MGIID:2384911 Length:160 Species:Mus musculus


Alignment Length:142 Identity:70/142 - (49%)
Similarity:101/142 - (71%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFT 131
            |:.||.|::::||.:|:|.....||.||.|.:.||..|.|:||.|.|.:.||..|||:.|:|.||
Mouse    19 IQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT 83

  Fly   132 TRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHD 196
            |:|||.|::|.|:||||:|..:|||.:.|:||||||..|:.:.|||||||..||..||:::.:::
Mouse    84 TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYN 148

  Fly   197 KIARHWTKLFAM 208
            :.||.||:.:||
Mouse   149 RHAREWTQKYAM 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 68/140 (49%)
UQ_con 66..203 CDD:278603 66/135 (49%)
Ube2d1XP_006513541.1 UBCc 19..159 CDD:381827 68/139 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.