DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and uev-3

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001361859.1 Gene:uev-3 / 185003 WormBaseID:WBGene00006732 Length:356 Species:Caenorhabditis elegans


Alignment Length:170 Identity:42/170 - (24%)
Similarity:70/170 - (41%) Gaps:50/170 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQVNSQTEMETEARARAEVEVEVEPEVLSRASVASSVEETAPSTSHSASGKSTEAPLTGCVVRIK 68
            |.:|.:...:.|   ::..::::..|.::|              |....||.    :.||::||.
 Worm   151 DGINYEKLKKVE---KSLCQIDIITEFMNR--------------SRHLQGKK----VNGCIMRID 194

  Fly    69 SELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFR----APRIR 129
            ...|                   |.:...::|||||:||||.|..||..   .|::    .||:.
 Worm   195 ETKQ-------------------LLFHVIIDGPVGSIYEGGTFFADINI---QPYQNHSLIPRVC 237

  Fly   130 FTTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYV 169
            |.|.|:|.|:...|.  .|:.|.:|....|: :||.:..|
 Worm   238 FHTFIFHPNLGKYGN--WDMRGIQWERRSNL-EVLYNFIV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 32/108 (30%)
UQ_con 66..203 CDD:278603 32/108 (30%)
uev-3NP_001361859.1 PHA03247 <9..73 CDD:223021
UBCc 185..319 CDD:381827 34/119 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.