DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and ubc-21

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_509502.3 Gene:ubc-21 / 182321 WormBaseID:WBGene00006716 Length:214 Species:Caenorhabditis elegans


Alignment Length:192 Identity:60/192 - (31%)
Similarity:89/192 - (46%) Gaps:34/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LSRASVASSVEETAPSTSHSASGKSTEAPLTGCVVRIK-SELQDIRKNPPPNCTADLHHGDLLHW 94
            |:.|.|....:|.|.::.      .|||   |..|.|| :.|.||:                   
 Worm    18 LALARVTRKCKEVANASD------ITEA---GIHVEIKENNLMDIK------------------- 54

  Fly    95 TAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTTRIYHCNVDSR-GAICLDVLGERWSPVM 158
             ..:.||.|:.|.||.|.:.:..|..|||..|:.:|.|||:|.|:.|: |.||||:|.::|:..:
 Worm    55 -GFIKGPEGTPYAGGTFEIKVDIPEHYPFEPPKAKFVTRIWHPNISSQTGTICLDILKDKWTASL 118

  Fly   159 NVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHDKIARHWTKLFAMTKAQ---DKNRE 217
            .:..||||:..::....|.||....:|.|:..|.......|.:||..||.:|..   |.||:
 Worm   119 TLRTVLLSLQAMLCSPEPSDPQDAVVAKQFINNYPMFTATAVYWTSYFANSKKDVEPDFNRK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 45/143 (31%)
UQ_con 66..203 CDD:278603 42/138 (30%)
ubc-21NP_509502.3 COG5078 15..167 CDD:227410 54/177 (31%)
UQ_con 25..163 CDD:278603 49/166 (30%)
UBA_II_E2_UBE2K_like 178..213 CDD:270498 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.