DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and UBE2E3

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001265483.1 Gene:UBE2E3 / 10477 HGNCID:12479 Length:207 Species:Homo sapiens


Alignment Length:216 Identity:97/216 - (44%)
Similarity:131/216 - (60%) Gaps:19/216 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSDQVNSQTEMETEARARAEVE----VEVEPEVLSRASVASSVEETAPSTSH-----SASGKST 56
            ||||:..|..|..:.:...::.:    ...|||         ..||..||.:.     ..|.|:|
Human     1 MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPE---------EQEERKPSATQQKKNTKLSSKTT 56

  Fly    57 EAPLTGCVVRIKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASY 121
             |.|:....||:.||.:|..:|||||:|.....::..|.:.:.||.|||||||.|.|||.|.:.|
Human    57 -AKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDY 120

  Fly   122 PFRAPRIRFTTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIAD 186
            ||:.|::.|.|||||||::|:|.||||:|.:.|||.:.::||||||..|:::|||.||||..||.
Human   121 PFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIAT 185

  Fly   187 QYKTNRREHDKIARHWTKLFA 207
            ||.|||.|||:|||.|||.:|
Human   186 QYLTNRAEHDRIARQWTKRYA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 79/142 (56%)
UQ_con 66..203 CDD:278603 75/136 (55%)
UBE2E3NP_001265483.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 18/71 (25%)
UQ_con 65..202 CDD:395127 75/136 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S139
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.