DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and ube2d4

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_012814892.1 Gene:ube2d4 / 100497147 XenbaseID:XB-GENE-962537 Length:159 Species:Xenopus tropicalis


Alignment Length:139 Identity:69/139 - (49%)
Similarity:98/139 - (70%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTTRI 134
            ||.|::::||..|:|.....||.||.|.:.||..|.::||.|.|.|.||..|||:.|::.|||:|
 Frog    21 ELMDLQRDPPAQCSAGPVGEDLFHWQATIMGPNDSPFQGGVFFLTIHFPTDYPFKPPKVAFTTKI 85

  Fly   135 YHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHDKIA 199
            ||.|::|.|:||||:|..:|||.:.|:||||||..|:.:.|||||||..||..||.:|.:::::|
 Frog    86 YHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLA 150

  Fly   200 RHWTKLFAM 208
            |.||:.:||
 Frog   151 REWTQKYAM 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 67/137 (49%)
UQ_con 66..203 CDD:278603 65/132 (49%)
ube2d4XP_012814892.1 COG5078 21..159 CDD:227410 67/137 (49%)
UBCc 21..158 CDD:294101 67/136 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.