DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and Ube2e1

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_038949665.1 Gene:Ube2e1 / 100366017 RGDID:2324438 Length:310 Species:Rattus norvegicus


Alignment Length:206 Identity:93/206 - (45%)
Similarity:121/206 - (58%) Gaps:27/206 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSDQVNSQTEMETEARARAEVEVEVEPEVLSRASVASSVEETAPSTSHSASGKSTEAPLTGCVVR 66
            ||...|.|||.|.....:.|.:|                     |.|.::...||.|.      |
  Rat   131 SSSSSNQQTEKEGSTPKKKESKV---------------------SMSKNSKLLSTSAK------R 168

  Fly    67 IKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFT 131
            |:.||.||..:|||||:|.....::..|.:.:.||.|||||||.|.|||.|...|||:.|::.|.
  Rat   169 IQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFR 233

  Fly   132 TRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHD 196
            |||||||::|:|.||||:|.:.|||.:.::||||||..|:::|||.||||..||.||.|||.|||
  Rat   234 TRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHD 298

  Fly   197 KIARHWTKLFA 207
            ::||.|||.:|
  Rat   299 RMARQWTKRYA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 79/142 (56%)
UQ_con 66..203 CDD:278603 75/136 (55%)
Ube2e1XP_038949665.1 PHA03378 <19..>108 CDD:223065
UQ_con 168..305 CDD:395127 75/136 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.