DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB9 and CG18599

DIOPT Version :10

Sequence 1:NP_076922.1 Gene:HOXB9 / 3219 HGNCID:5120 Length:250 Species:Homo sapiens
Sequence 2:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster


Alignment Length:138 Identity:43/138 - (31%)
Similarity:61/138 - (44%) Gaps:20/138 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   109 PGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQT 173
            |.|...|..|..:..||..|  |...:...:..|.::|.||.||             :|.:.|..
  Fly   260 PHQAGFAAVAAAVGAAPSAL--QSLQQLHQQHHAQQQATLSFQR-------------EKLKSDSH 309

Human   174 NPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRM 238
            ..|     |..:::.|..:|..|...||.||....|:....|..:|..|.|:|.|||:||||||:
  Fly   310 KKS-----ALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRI 369

Human   239 KMKKMNKE 246
            |.:|.:.|
  Fly   370 KWRKHHLE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB9NP_076922.1 Hox9_act 1..172 CDD:461369 15/62 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..47
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..182 6/32 (19%)
Homeodomain 186..242 CDD:459649 23/55 (42%)
CG18599NP_650701.1 Homeodomain 317..373 CDD:459649 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.