DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB9 and bcd

DIOPT Version :10

Sequence 1:NP_076922.1 Gene:HOXB9 / 3219 HGNCID:5120 Length:250 Species:Homo sapiens
Sequence 2:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster


Alignment Length:180 Identity:50/180 - (27%)
Similarity:68/180 - (37%) Gaps:37/180 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    78 YHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELL---KQGTPEYSLE 139
            :||.......|...|       .|.|.....|......::..|....|.:||   :.|...|:. 
  Fly    12 HHPLPHTHTHPHPHS-------HPHPHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNY- 68

Human   140 TSAGREAVLSNQRPGYGDNKICEGSED----KERPDQTNPSANWLHARSSRKKRCPYTKYQTLEL 200
                ....|.||.|          ..|    :|.||.       |..|..|:.|..:|..|..||
  Fly    69 ----IRPYLPNQMP----------KPDVFPSEELPDS-------LVMRRPRRTRTTFTSSQIAEL 112

Human   201 EKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE 250
            |:.||...|||..|..:::..|.|...||||||:||| :..|:..:|.|:
  Fly   113 EQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRR-RRHKIQSDQHKD 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB9NP_076922.1 Hox9_act 1..172 CDD:461369 20/100 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..47
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..182 8/36 (22%)
Homeodomain 186..242 CDD:459649 24/55 (44%)
bcdNP_788587.1 Homeodomain 106..153 CDD:459649 21/47 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.