DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB9 and lms

DIOPT Version :10

Sequence 1:NP_076922.1 Gene:HOXB9 / 3219 HGNCID:5120 Length:250 Species:Homo sapiens
Sequence 2:NP_611491.2 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster


Alignment Length:154 Identity:43/154 - (27%)
Similarity:64/154 - (41%) Gaps:38/154 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   113 QAAVKAEP-------LLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERP 170
            |:||:..|       :|..| |:....:.|.|::..:||           |.|  |.|:.....|
  Fly     4 QSAVRRYPHSFSIEQILAKP-EMRSSTSFEDSVQDESGR-----------GGN--CLGASRASSP 54

Human   171 -----------------DQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEV 218
                             |..:...|.|.....::.|..::..|...||.||....||:..:|..:
  Fly    55 ATSSCLDDNMDDGKSDIDLASDDGNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTAL 119

Human   219 ARLLNLSERQVKIWFQNRRMKMKK 242
            |:.|.|:|.|:||||||||.|.|:
  Fly   120 AKQLQLTETQIKIWFQNRRTKWKR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB9NP_076922.1 Hox9_act 1..172 CDD:461369 16/82 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..47
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..182 8/49 (16%)
Homeodomain 186..242 CDD:459649 23/55 (42%)
lmsNP_611491.2 Cnd2 33..>106 CDD:450400 16/85 (19%)
Homeodomain 87..143 CDD:459649 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.