DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB9 and CG11085

DIOPT Version :10

Sequence 1:NP_076922.1 Gene:HOXB9 / 3219 HGNCID:5120 Length:250 Species:Homo sapiens
Sequence 2:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster


Alignment Length:142 Identity:28/142 - (19%)
Similarity:46/142 - (32%) Gaps:57/142 - (40%)


- Green bases have known domain annotations that are detailed below.


Human    89 VISRIEKMGGATSRGENSYGLDITCKDLRNLRFALKQE-------------------GHSRRDMF 134
            :|..:::      ||.:....|..|..:|  |..:|:.                   |.|::| |
  Fly    97 IIDEVDQ------RGNHQIDFDEFCVVMR--RLTMKKSNWNEVVKECFTVFDRSENGGISKKD-F 152

Human   135 EILVKHAFPLAHNLPLFAFVNEEKFNVDGWTVYNPVEEYRRQGLPNHHWRISFINKCYELCETYP 199
            ..:::....:..|..:....||.  :|||    |.|.:|..                    .|| 
  Fly   153 RFILRELGDITDNQIIDEIFNEA--DVDG----NGVIDYDE--------------------FTY- 190

Human   200 ALLVVPYRTSDD 211
              :|..|.|.||
  Fly   191 --MVKNYMTDDD 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB9NP_076922.1 Hox9_act 1..172 CDD:461369 20/101 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..47
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..182 8/32 (25%)
Homeodomain 186..242 CDD:459649 7/26 (27%)
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649 16/69 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.