DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and grik5-like.1

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_001072565.1 Gene:grik5-like.1 / 780020 XenbaseID:XB-GENE-5860197 Length:479 Species:Xenopus tropicalis


Alignment Length:431 Identity:89/431 - (20%)
Similarity:154/431 - (35%) Gaps:120/431 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 LAGIDWDLLQLLAKALKFRIQLYMPQEPSQIFG----EGNVSGCFRQLADGTVSIAIGGL--SGS 331
            :.|...|||..||::|.|...:...::..  :|    :||.:|...::......:|:..|  :|:
 Frog    61 MEGFCIDLLSELAQSLGFNYTIKEVKDGR--YGAKDQDGNWNGMVGEVLRKEADLAVAPLTITGA 123

  Fly   332 DKRRSLFSKSTVYHQSNFVMVVRRD-----RYLGRLGPLILPFRGKLW-GVIIV-------ILLL 383
            .:|...|:|.  :.|:...:::|:|     .||  .| .:.||..:.| |:::.       :.|:
 Frog   124 RERELAFTKP--FMQTGISILLRKDDVSENSYL--FG-FLTPFSKETWIGILVAYVVTSLCLFLV 183

  Fly   384 AVLSTC-WLRSRLGLSHPIEDLLTVI---VG----NPIPDHRLPGKGFLRYLLASWMLLTLVLRC 440
            ..||.| |  :.|.......:.|..:   ||    .....|  |.....|.:...|.:.::||..
 Frog   184 GRLSPCEW--TELSTEQNNFNFLNSLWFGVGAFTLQGAEPH--PKSVSARIIAVIWWIFSIVLVA 244

  Fly   441 AYQARLFDVLR--------------LSRHRPLPKDLSGLIKDN-------------YTMVANGYH 478
            ||.|.....|.              |...|.|.   .|.|..:             |.|:.. |.
 Frog   245 AYIASFAAFLNSDSMQTTNIQTFEDLVNQRTLE---FGTINSSSTFQFFKNSKNPTYRMIYE-YM 305

  Fly   479 DFYPLELTCRQPLDFSARFERVQRAAPDERLTTIALISNLAYWNH---------KHPNISRLTFV 534
            |....||..:   .|:....||:.             ||.|:...         ||.::     |
 Frog   306 DKRKDELLVK---SFAEGVRRVKE-------------SNYAFLGESVMQDIMVAKHCDL-----V 349

  Fly   535 RQPIYMYHLVIYFPRRFFLRPAIDRKIKQLLSAGVMAHIERRYMQYE---------NKRKVASND 590
            |.|      .|...|.:.:..::|..:.:.||..::...|...::|.         |.::.|..:
 Frog   350 RAP------QIIAGRGYGIAASLDSPLIKPLSVAILEQTESGNIEYLRKKWWDNTCNMKRSAGWN 408

  Fly   591 PVLLRRITKSIMNGAYRIHGLVIVLATGMFILEL-LAGRSN 630
            ||     ....:.|.:.|.|:.:.|.....::|| |..|:|
 Frog   409 PV-----QPHTLGGIFLILGIGLALGVIAALVELVLKARNN 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 11/51 (22%)
grik5-like.1NP_001072565.1 PBP2_iGluR_non_NMDA_like 41..396 CDD:270403 76/376 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.