DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and grin2ab

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:XP_009304490.1 Gene:grin2ab / 570493 ZFINID:ZDB-GENE-070424-223 Length:1445 Species:Danio rerio


Alignment Length:387 Identity:62/387 - (16%)
Similarity:122/387 - (31%) Gaps:138/387 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 DLLQLLAKALKFRIQLYMPQEPSQIFGEGNV-SGCFRQLADGTVSIAIGGLSGSDKRRSLFSKST 342
            |:|:.:|:.:||...||:...........|| :|...::......:|:|.|:.:::|......|.
Zfish   450 DILKKIARNVKFTYDLYLVTNGKHGKKINNVWNGMVGEVVYKKAVMAVGSLTINEERSEAIDFSV 514

  Fly   343 VYHQSNFVMVVRRDRYLGRLGP--LILPFRGKLWGVIIVILLLAVLSTCWL---RSRLGLSHPIE 402
            .:.::...::|.|..  |.:.|  .:.||...:|.::.|:||:......:|   .|.||.:..:.
Zfish   515 PFVETGISVMVSRSN--GTVSPSAFLEPFSASVWVMMFVMLLIVTAIAVFLFEFISPLGFNRNLA 577

  Fly   403 D-----------------LLTVIVGNPIPDHRLPGKGFLRYLLASWMLLTLVLRCAYQARLFDVL 450
            .                 |..::..|.:|... |.....:::::.|....::...:|.|.|    
Zfish   578 QGKDPHGPSFTIGKAVWLLWGLVFNNSVPVQN-PRGTTSKFIVSVWAFFAVIFLASYTANL---- 637

  Fly   451 RLSRHRPLPKDLSGLIKDNYTMVANGYHDFYPLELTCRQPLDFSARFERVQRAAPDERLTTIALI 515
                       .:.:|::.:.....|..|               .:|:.....:|..|..|:   
Zfish   638 -----------AAFMIQEEFVDQVTGLSD---------------RKFQSPYSYSPPFRFGTV--- 673

  Fly   516 SNLAYWNHKHPNISRLTFVRQPIYMYHLVIYFPRRFFLRPAIDRKIKQLLSAGVMAHIERRYMQY 580
                      ||.|                                                   
Zfish   674 ----------PNGS--------------------------------------------------- 677

  Fly   581 ENKRKVASNDPVLLRRITKSIMNGAYRIHGLV---IVLATGMF--------ILELLAGRSNG 631
             .:|.:..|.|.:.:.:.|      |...|:|   :.|.||..        :|..:|||.:|
Zfish   678 -TERNIRKNYPAMHQYMVK------YHQTGVVDALVSLKTGKLDAFIYDAAVLNYMAGRDDG 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 9/50 (18%)
grin2abXP_009304490.1 PBP1_iGluR_NMDA_NR2 25..382 CDD:107373
ANF_receptor 48..358 CDD:279440
PBP2_iGluR_NMDA_Nr2 393..790 CDD:270436 62/387 (16%)
Lig_chan 544..816 CDD:278489 41/291 (14%)
NMDAR2_C 827..1445 CDD:287527
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.