DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and Ir92a

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster


Alignment Length:488 Identity:86/488 - (17%)
Similarity:166/488 - (34%) Gaps:133/488 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 DLYPVRNGHLGDCPFNVGAAHMPPHLIY------KRHKDP--PPASNVSIPAEDLAGIDWDLLQL 283
            :|||.:..:|......||:....|:.|.      :...||  |...|.|:..:   |.:.::::.
  Fly   233 ELYPNKLLNLQRRSLLVGSITYVPYTITNYVPAGQGDVDPIHPQWPNRSLTFD---GAEANVMKT 294

  Fly   284 LAKA--LKFRIQLYMPQEPSQIFGEGNVSGCFRQLADGTVSIAIGGL----SGSDKRRSLFSKST 342
            ..:.  ...|::.|.......|:...:..|....:.:..|.:|||.:    .|..:.....::|:
  Fly   295 FCQVHNCHLRVEAYGADNWGGIYDNESSDGMLGDIYEQRVEMAIGCIYNWYDGITETSHTIARSS 359

  Fly   343 VYHQSNFVMVVRRDRYLGRLGPL----------ILPFRGKLWGVIIVILLLAVLSTC-------- 389
            |                ..|||.          |:||..:.|     ::|::.|..|        
  Fly   360 V----------------TILGPAPAPLPSWRTNIMPFNNRAW-----LVLISTLVICGTFLYFMK 403

  Fly   390 WLRSRL-------------GLSHPIEDLLTVIVGNPIP----DHRLPGKGFLRYLLASWMLLTLV 437
            ::..||             .|...:.|:..:.:..|..    |...|     |:.||:.:..|:.
  Fly   404 YVSYRLRYSGTQVKFHHSRKLEKSMLDIFALFIQQPSAPLSFDRFAP-----RFFLATILCATIT 463

  Fly   438 LRCAYQARLFDVLRLSRHRPLPKDLSGLIKDNYTMVANGYHDFYPLELTCRQPLDFSARFERVQR 502
            |...|..:|..:|....:......:....:..:...|......:.::         |:..|..|.
  Fly   464 LENIYSGQLKSMLTFPFYSAPVDTIEKWAQSGWKWSAPSIIWVHTVQ---------SSDLETEQI 519

  Fly   503 AAPDERLTTIALISNLAYWNHKHPNISRL------------TFVRQPIYMYHLVIYFP------- 548
            .|.:..:...:.:||:::..:....|.||            |...:...:.|..:||.       
  Fly   520 LARNFEVHDYSYLSNVSFMPNYGFGIERLSSGSLSVGDYVSTEALENRIVLHDDLYFDYTRAVSI 584

  Fly   549 RRFFLRPAIDRKIKQLLSAGVMAHIERRYM-QYENKRKVASNDPVLLRRITKSIMNG-------- 604
            |.:.|.|.:::.|:.....|:..|.|..:: :|.:|:|         :.:...:.||        
  Fly   585 RGWILMPELNKHIRTCQETGLYFHWELEFIDKYMDKKK---------QEVLMDLANGHKVKGAPQ 640

  Fly   605 ---AYRIHGLVIVLATGM------FILELLAGR 628
               ...|.|.:.|||.|:      .:.|||..|
  Fly   641 ALDVRNIAGALFVLAFGVAFAGCALVAELLIHR 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 8/53 (15%)
Ir92aNP_001097845.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.