DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and GluRIA

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_476855.1 Gene:GluRIA / 38742 FlyBaseID:FBgn0004619 Length:991 Species:Drosophila melanogaster


Alignment Length:358 Identity:64/358 - (17%)
Similarity:119/358 - (33%) Gaps:102/358 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 EDLAGID------WDLLQLLAKALKFRIQLYMPQE----PSQIFGEGNVSGCFRQLADGTVSIAI 325
            |.|.|.|      .||..:||..|..:.::.:.|:    ....:..|...|...:|......|||
  Fly   500 ESLVGNDRFEGYCKDLADMLAAQLGIKYEIRLVQDGNYGAENQYAPGGWDGMVGELIRKEADIAI 564

  Fly   326 GGLSGSDKRRSLFSKSTVYHQSNF-VMVVRRDRYLGRLGPLILPFRGKLWGVIIVILLLAVLSTC 389
            ..::.:.:|..:...|..:..... :|:.:..:....:...:.|...::| :.:::..:.|....
  Fly   565 SAMTITAERERVIDFSKPFMTLGISIMIKKPVKQTPGVFSFLNPLSQEIW-ISVILSYVGVSFVL 628

  Fly   390 WLRSRLG------LSHPIEDLLTV----IVGN-----------PIPDHRLPGKGFLRYLLAS--- 430
            :..:|..      :..|..|....    |:|.           |:|.:.........|.||:   
  Fly   629 YFVTRFPPYEWRIVRRPQADSTAQQPPGIIGGATLSEPQAHVPPVPPNEFTMLNSFWYSLAAFMQ 693

  Fly   431 ------------------WMLLTLVLRCAYQARLFDVLRLSRH-RPL--PKDLSGLIKDNY-TMV 473
                              |...|::|..:|.|.|...|.:.|. .|:  |:||:.....|| |::
  Fly   694 QGCDITPPSIAGRIAAAVWWFFTIILISSYTANLAAFLTVERMVAPIKTPEDLTMQTDVNYGTLL 758

  Fly   474 ANGYHDFYPLELTCRQPLDFSARFERVQRAAPDERLTTIALISNLAYWNHKHPN----------- 527
            .....:|:                          |.:.|.|.:.:  |.:.:.|           
  Fly   759 YGSTWEFF--------------------------RRSQIGLHNKM--WEYMNANQHHSVHTYDEG 795

  Fly   528 ISRLTFVRQPIYMYHLVIYFPRRFFL--RPAID 558
            |.|   |||....|.|::..|:..::  ||..|
  Fly   796 IRR---VRQSKGKYALLVESPKNEYVNARPPCD 825

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 9/50 (18%)
GluRIANP_476855.1 PBP1_iGluR_AMPA 41..453 CDD:107375
ANF_receptor 53..434 CDD:279440
PBP2_iGluR_AMPA 477..879 CDD:270433 64/358 (18%)
Lig_chan 612..907 CDD:278489 44/246 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.