DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and Ir60e

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_611927.3 Gene:Ir60e / 37917 FlyBaseID:FBgn0035019 Length:572 Species:Drosophila melanogaster


Alignment Length:410 Identity:93/410 - (22%)
Similarity:150/410 - (36%) Gaps:112/410 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 IPAEDLAGIDWDLLQLLAKALKFRIQLYMPQE---PSQIFGEGNVSGCFRQLADGTVSIAIGGLS 329
            :.|.|...:...:||.|..||:..:.:::..|   .|:|         ..:|....:.::.....
  Fly    18 VGASDSESMQVQVLQDLNLALQTELNVFIDFECCATSEI---------LHKLDSPRILLSSNSRE 73

  Fly   330 GSDKR-RSLFSKSTVYHQSNFVMVVRRDRYLGRLGPLILP-FRGKLWGVIIVILLLAVLSTCWLR 392
            ..|.| |..|::||:      ::|...|..|..|...:|| ...:|..:.||.|           
  Fly    74 ARDLRIRGNFTESTL------IIVSVMDSDLNPLVASLLPRLLDELHELHIVFL----------- 121

  Fly   393 SRLGLSHPIEDLLT---------VIVGNPIPDHRLPGKGFLRYL-LASWMLLTLVLRCAY--QAR 445
            |......|.:||.|         ||:        :.|||...|| ..|...::|.....|  :||
  Fly   122 SNEEPGFPKQDLYTYCFKEGFVNVIL--------MSGKGLYSYLPYPSIQPISLSNVSEYFDRAR 178

  Fly   446 L------FDVLRLSRHRPLPKDL------SGLIKDNYTMVANGYHDFYPLELTCRQPLDFSARFE 498
            :      |.| |:.|....|:|.      .||::..|...|       ..|||.|    ::|..|
  Fly   179 IIRNFQGFPV-RILRSTLAPRDFEYSNEQGGLVRAGYLFTA-------VKELTYR----YNATIE 231

  Fly   499 RVQRAAPD-----------ERLTT--IALISNLAYWNHKHPNISRLTFVRQ--------PIYMYH 542
            .|  ..||           |.|.|  |.::.....::.:....:.|:.:|:        ||..| 
  Fly   232 SV--PIPDLPEYDVYLAVAEMLHTKKIDIVCYFKDFSLEVAYTAPLSIIREYFMAPHARPISSY- 293

  Fly   543 LVIYFPRRF--FLRPAIDRKIKQLLSAGVMAHIERRYMQYENKRKVASNDPVLLRRITKSIMNGA 605
              :|:.:.|  .|...:   |..:|...||.|:..|..:.|..:.:..:...:|....:.|....
  Fly   294 --LYYSKPFGWTLWAVV---ISTVLYGTVMLHLAARGARVEIGKCLLYSLSHILYNCHQKIRVAG 353

  Fly   606 YR---IHGLVIVLATGMFIL 622
            :|   |||   :|..|.|||
  Fly   354 WRDVAIHG---ILTIGGFIL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 8/50 (16%)
Ir60eNP_611927.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.