DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and Ir56d

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_611432.1 Gene:Ir56d / 37252 FlyBaseID:FBgn0034458 Length:632 Species:Drosophila melanogaster


Alignment Length:339 Identity:65/339 - (19%)
Similarity:119/339 - (35%) Gaps:109/339 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 LILPFRGK--------------LWGVIIVILLLAV--------------LSTCWLRSRLGLSHPI 401
            :::|:|.:              :| |:|.:..|.:              ||..:|:|...|::.:
  Fly   316 IMVPYRNQSPADQYMHEALQENVW-VLISLFTLYITVAIYLCSPLRPRDLSAAFLQSICTLTYSV 379

  Fly   402 EDLLTVIVGNPIPDHRLPGKGFLRYLLASWMLLTLVLRCAYQARLFDVLRLSRHRPLPKDLSGLI 466
            .   |.|:..|....|     :|..|||.|.::|..|..:.....|......|.....:|   ::
  Fly   380 P---TFIIRTPTLRMR-----YLYILLAIWGIVTSNLYISRMTSYFTTAPPVRQINTVQD---VV 433

  Fly   467 KDN--YTMVANGYHDFYPLELTCRQPLDFSARFERVQRAAPDERLTTIALISNLAYWNHKHP--- 526
            :.|  ..|:|..|      |...:.||.:           |:..|..:.|:.......|:.|   
  Fly   434 EANLRIKMLAIEY------ERMAKSPLQY-----------PESYLNQVDLVDKHMLDLHRDPFNT 481

  Fly   527 --------------NISRLTFVRQPIY---------MYHLVIYFP--RRFFLRPAIDRKIKQLLS 566
                          |:.:| .:|:||:         .||:   ||  :...:|..:...|.....
  Fly   482 SFGYTVSSDRWRFLNLQQL-HLRKPIFRLTEICEGPFYHV---FPLHKDSHMRSVMTEYIMIAQQ 542

  Fly   567 AGVMAHIERR-YMQYENKRKV----ASNDPVLLRRITKSIMNGAYRIHGLVIVLATGMFILELLA 626
            ||:|.|.||. :.:..:..::    ..::|:.|   :....:...|...|.::||...|..|:  
  Fly   543 AGLMNHWERETFWEAVHLHRIHVHLFDDEPMAL---SLDFFSSLLRTWTLGLILAGLAFAAEM-- 602

  Fly   627 GRSNGRLRRWMEWV 640
                    :|.|.|
  Fly   603 --------KWHEHV 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360
Ir56dNP_611432.1 ATPase-IIIA_H <312..422 CDD:273731 23/114 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.