DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and Ir56b

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:115 Identity:24/115 - (20%)
Similarity:41/115 - (35%) Gaps:23/115 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 YQARLFDVLRLSRHRPLPKDL---SGLIKDNYTMVANGYHDFYPLELTCRQPLDFSARFERVQRA 503
            |..:||    |.....|||..   ..:|...|.:..:|         ...:|.:.|..|...|.:
  Fly    51 YHYQLF----LDSLESLPKKSVVEQDIISGKYNLSLHG---------VIIRPEETSDFFNATQHS 102

  Fly   504 APDERLTTIALISNLAYWNHKHPNISRLTFVRQPIYMYHLVIYFPRRFFL 553
            .|.|.:|...::. ||      |.:.:..::..|:..|.....|...|::
  Fly   103 YPLELMTNCVMVP-LA------PELPKWMYMVWPLGKYIWTCLFLGTFYV 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360
Ir56bNP_611430.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.