DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and clumsy

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_001036373.1 Gene:clumsy / 35394 FlyBaseID:FBgn0026255 Length:1002 Species:Drosophila melanogaster


Alignment Length:428 Identity:82/428 - (19%)
Similarity:131/428 - (30%) Gaps:133/428 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 GIDWDLLQLLAKALKFRIQLYMPQEPSQIFGEGNV-----SGCFRQLADGTVSIAIGGLSGSDKR 334
            |...||:..:||.|.|:.:..|  .|...:|..|.     .|..|||.||...:.|..|:.:..|
  Fly   447 GYSIDLINEIAKMLNFKFEFRM--SPDGKYGALNKVTQTWDGIVRQLIDGNADLGICDLTMTSSR 509

  Fly   335 RS---------------LFSKSTVYHQSNFVMVVRRDRYLGRLGPLILPFRGKLW-----GVIIV 379
            |.               ||||........|              ..:.||...:|     ..:.:
  Fly   510 RQAVDFTPPFMTLGISILFSKPPTPPTDLF--------------SFLSPFSLDVWIYMGSAYLFI 560

  Fly   380 ILLL---------------------------AVLSTCWLR--SRLGLSHPIEDLLTVIVGNPIPD 415
            .|||                           ::::|.||.  |.:|....|              
  Fly   561 SLLLFALARMAPDDWENPHPCKEPEEVENIWSIMNTTWLSIGSLMGQGCDI-------------- 611

  Fly   416 HRLPGKGFLRYLLASWMLLTLVLRCAYQARLFDVLRLSRHR---PLPKDLSGLIKDNYTMVANG- 476
              ||.....|.:...|....|::..:|.|.|...|..||..   ...:||:...|..|..:|.| 
  Fly   612 --LPKAASTRLVTGMWWFFALMMLNSYTANLAAFLTNSRQANSINSAEDLAAQSKIKYGAMAGGS 674

  Fly   477 ------------YHDFYPLELTCRQPLDFSARFERVQRAAPDERLTTIALIS-NLAYWNHKHPNI 528
                        |...:....:....:......|.|:|....:.|....:.| .|.|      |:
  Fly   675 TMGFFRDSNFSTYQKMWTAMESASPSVFTKTNDEGVERVQKGKNLYAFLMESTTLEY------NV 733

  Fly   529 SRLTFVRQ-----PIYMYHLVIYFPRRFFLRPAIDRKIKQLLSAGVMAHIERRYMQ-------YE 581
            .|...:.|     ....|.:.:.|...:  |..|...:.:|...|.:|.::|::.:       .|
  Fly   734 ERKCDLVQIGGWLDYKSYGIAMPFNSPY--RKQISAAVLKLGELGQLAELKRKWWKEMHGGGNCE 796

  Fly   582 NKRKVASNDPVLLRRITKSIMNGAYRIHGLVIVLATGM 619
            ...:...:.|.|          |...:.|:.:||..|:
  Fly   797 KSDEDGGDTPEL----------GLENVGGVFLVLGLGL 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 16/69 (23%)
clumsyNP_001036373.1 PBP1_iGluR_Kainate 26..396 CDD:107377
ANF_receptor 39..379 CDD:279440
PBP2_iGluR_Kainate 414..787 CDD:270432 74/379 (20%)
Lig_chan 548..812 CDD:278489 50/297 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.