DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and Ir25a

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_001260049.1 Gene:Ir25a / 33683 FlyBaseID:FBgn0031634 Length:947 Species:Drosophila melanogaster


Alignment Length:292 Identity:57/292 - (19%)
Similarity:100/292 - (34%) Gaps:75/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 DLLQLLAKALKFRIQLYMPQEPSQ-IFG----EGNVSGCFRQLADGTVSIAIGGLSGSDKRRSLF 338
            ||:..:|..:.|.   |..||... .||    .|..:|..::|.|....|.:|.:|...:|..:.
  Fly   468 DLINEIAAIVHFD---YTIQEVEDGKFGNMDENGQWNGIVKKLMDKQADIGLGSMSVMAEREIVI 529

  Fly   339 SKSTVYHQ-SNFVMVVRRDRYLGRLGPLILPFRGKLWGVIIVILLLAVLSTCWL----------- 391
            ..:..|:. ....::::|......|...:......:|    :.:|.|...|.:|           
  Fly   530 DFTVPYYDLVGITIMMQRPSSPSSLFKFLTVLETNVW----LCILAAYFFTSFLMWIFDRWSPYS 590

  Fly   392 -------------RSRLGLSHPIEDLLTVIV---GNPIPDHRLPGKGFLRYLLASWMLLTLVLRC 440
                         :....|...:...:|.:.   |...|.: |.|    |.:.|:|.|...::..
  Fly   591 YQNNREKYKDDEEKREFNLKECLWFCMTSLTPQGGGEAPKN-LSG----RLVAATWWLFGFIIIA 650

  Fly   441 AYQARLFDVLRLSRHRPLPKDLSGLIKDNYTMVANGYHDFYPLELTCRQPLDFSAR---FERVQR 502
            :|.|.|...|.:||.....:.|..|.|....:.|               ||:.|:.   |||:..
  Fly   651 SYTANLAAFLTVSRLDTPVESLDDLAKQYKILYA---------------PLNGSSAMTYFERMSN 700

  Fly   503 -----------AAPDERLTTIALISNLAYWNH 523
                       .:.::.||.:.. |.||.|::
  Fly   701 IEQMFYEIWKDLSLNDSLTAVER-SKLAVWDY 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 9/50 (18%)
Ir25aNP_001260049.1 PBP1_iGluR_AMPA_Like 40..426 CDD:107378
PBP2_iGluR_putative 438..836 CDD:270435 57/292 (20%)
Lig_chan 565..870 CDD:278489 37/192 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.