DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and gria4b

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_997917.2 Gene:gria4b / 336069 ZFINID:ZDB-GENE-030131-8013 Length:904 Species:Danio rerio


Alignment Length:222 Identity:44/222 - (19%)
Similarity:80/222 - (36%) Gaps:49/222 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 EDLAGIDWDLLQLLAKALKFRIQL-------YMPQEPSQIFGEGNVSGCFRQLADGTVSIAIGGL 328
            |...|...||...:||.:.|:.::       |..::|......|.|.    :|..|...||:..|
Zfish   441 EQYEGYCVDLASEIAKHIGFKYKISIVPDGKYGARDPETKIWNGMVG----ELVYGKAEIAVAPL 501

  Fly   329 SGSDKRRSLFSKSTVYHQSNFVMVVRRDRYLGRLGPLIL----PFRGKLW--------GVIIVIL 381
            :.:..|..:...|..:......:::::.:   :..|.:.    |...::|        ||.:|:.
Zfish   502 TITLVREEVIDFSKPFMSLGISIMIKKPQ---KSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLF 563

  Fly   382 LLAVLS------------TCWLRS-----RLGLSHPIEDLLTVIV--GNPIPDHRLPGKGFLRYL 427
            |::..|            |..|.|     ..|:.:.:...|...:  |..|....|.|    |.:
Zfish   564 LVSRFSPYEWHTEEPEEGTDGLPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSG----RIV 624

  Fly   428 LASWMLLTLVLRCAYQARLFDVLRLSR 454
            ...|...||::..:|.|.|...|.:.|
Zfish   625 GGVWWFFTLIIISSYTANLAAFLTVER 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 9/49 (18%)
gria4bNP_997917.2 Periplasmic_Binding_Protein_Type_1 28..398 CDD:324556
PBP2_iGluR_AMPA_GluR4 414..793 CDD:270445 44/222 (20%)
Lig_chan 546..827 CDD:306551 24/110 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.