DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and Ir94b

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_732700.2 Gene:Ir94b / 318728 FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster


Alignment Length:264 Identity:51/264 - (19%)
Similarity:81/264 - (30%) Gaps:76/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 VIIVILLLAVLSTCWLRSRLGLSHPIEDLLT------VIVGNPIPDHRLPGKGFLRYLLASWMLL 434
            ||.|::.:..|....|.||......|.:.|.      .|:|.|.|:.|..... ||.|..:..|.
  Fly   305 VIFVLIEITFLGVTILISRQSRHQMIPNTLVNLCAFRAILGLPFPETRRTSLS-LRQLFLAIALF 368

  Fly   435 TLVLRCAYQARLFDVLRLSRHRPLPKDLSGLIKDNYTMVANGYHD---FYPLELTCRQPLDFSAR 496
            .::.......:|..:|.....||...:...|.....|:|.:  ||   |...|:           
  Fly   369 GMIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTVVMD--HDAENFIEKEI----------- 420

  Fly   497 FERVQRAAPDERLTTIALISNLAYWNHKHPNISRLTFVRQPIYMY-----HLVIYFPRRFFLRPA 556
                                .:.::|...|....|||..:...::     |....|...|.:..:
  Fly   421 --------------------GVDFFNQYMPRKVTLTFTERAKLLFSLKGNHAFTLFSESFAIIES 465

  Fly   557 IDRKIKQLLSAGVMAH-----------IERRYMQYENKRKVASNDPVL---LRRITKSIMNGAYR 607
            ..|      |.|:.||           :.|.|        :..|:.:|   |||..:.:......
  Fly   466 YQR------SKGLRAHCTSEDLIVAERVPRIY--------ILENNSILDRPLRRFIRQMQESGIT 516

  Fly   608 IHGL 611
            .|.|
  Fly   517 NHWL 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360
Ir94bNP_732700.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.