DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and GRIN2C

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:XP_016880033.1 Gene:GRIN2C / 2905 HGNCID:4587 Length:1337 Species:Homo sapiens


Alignment Length:332 Identity:64/332 - (19%)
Similarity:122/332 - (36%) Gaps:90/332 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LGDCPFNV------GAAHMPPHLIYKRHKDPPPASNVSIPAEDLA--------GIDWDLLQLLAK 286
            |.:.||.:      |.....|:.:..|.:     ||.:..:.|:|        |...|:|:.||:
Human   483 LEERPFVIVESPDPGTGGCVPNTVPCRRQ-----SNHTFSSGDVAPYTKLCCKGFCIDILKKLAR 542

  Fly   287 ALKFRIQLYM---PQEPSQIFG--EGNVSGCFRQLADGTVSIAIGGLSGSDKRRSLFSKSTVYHQ 346
            .:||...||:   .:...::.|  .|.:...:.:.||    :|||.|:.:::|..:...|..:.:
Human   543 VVKFSYDLYLVTNGKHGKRVRGVWNGMIGEVYYKRAD----MAIGSLTINEERSEIVDFSVPFVE 603

  Fly   347 SNFVMVVRRDRYLGRLGP--LILPFRGKLWGVIIVILLLAVLSTCWL--------------RSR- 394
            :...::|.|..  |.:.|  .:.|:...:|.::.|:.|..|..|.::              |.: 
Human   604 TGISVMVARSN--GTVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTRGKK 666

  Fly   395 -------LGLSHPIEDLLTVIVGNPIPDHRLPGKGFLRYLLASWMLLTLVLRCAYQARLFDVLRL 452
                   :|.|  :..|..::..|.:|... |.....:.::..|....::...:|.|.|      
Human   667 SGGPAFTIGKS--VWLLWALVFNNSVPIEN-PRGTTSKIMVLVWAFFAVIFLASYTANL------ 722

  Fly   453 SRHRPLPKDLSGLIKDNYTMVANGYHDFYPLELT------------CRQPLDFSARFERVQRAAP 505
                     .:.:|::.|....:|..|...|.|.            |      |..|:|.|...|
Human   723 ---------AAFMIQEQYIDTVSGLSDKKSLHLENTGVAWTAFKTFC------SDYFQRPQDQYP 772

  Fly   506 DERLTTI 512
            ..|..|:
Human   773 PFRFGTV 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 10/49 (20%)
GRIN2CXP_016880033.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.