DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and Ir52b

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_725469.2 Gene:Ir52b / 246631 FlyBaseID:FBgn0050469 Length:596 Species:Drosophila melanogaster


Alignment Length:502 Identity:100/502 - (19%)
Similarity:170/502 - (33%) Gaps:161/502 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 INHFDRITGKPQQSMPDLYPVRNGHLGDCPFNVGAAHMPPHLIYKRHKDPPPASNVSIPAE-DLA 274
            |..|..:.||..:.:|||.|                  |..::|:...|          .| .:.
  Fly   174 IEQFQNMKGKAIRIVPDLLP------------------PRVMLYQDAND----------GELKMI 210

  Fly   275 GIDWDLLQLLAKALKFRIQLYMPQEPSQIFGEGNVSGCFRQLADGTVSIAIGGLSGSDKRRSLFS 339
            |...:|:...|:.:...:||.. .:||.     :::...|...|..:.:.| .|..|....:|.:
  Fly   211 GYVANLITNFAQKVNATLQLDF-LKPST-----SITEISRMAKDDELDMGI-TLEASLNTSNLET 268

  Fly   340 KSTVYHQSNFVMVVRRDR-------YLGRLGPLILPFRGKLWGVIIVI-LLLAVL-----STCW- 390
            .|..|..:::.::|:...       |...:.||:|       |:|.|: |||:||     ...| 
  Fly   269 SSYPYLLTSYCLMVQVPAKFPYNLVYALIVDPLVL-------GIIFVLFLLLSVLLIYSQKMSWQ 326

  Fly   391 -------------LRSRLGLSHPIEDLLTVIVGNPIPDHRLPGKGFLRYLLASWMLLTLVLR--- 439
                         ||..||.|.|.          |:...:.....|.....||.||.|:...   
  Fly   327 DLSVANILLNDKSLRGLLGQSFPF----------PLNASKKLRLIFTILCFASIMLTTMYEAYLQ 381

  Fly   440 ------------CAYQARLFDVLRLSRHRPLPK-DLSGLIKDNYTMVANGYHDFYPLELTCRQPL 491
                        |::|    ||...:|...:.. :::||||.|.:.......|  .||:....|.
  Fly   382 SFFTNPPSEPEICSFQ----DVGSYNRRIAMSALEVNGLIKTNNSHFREIRMD--DLEIFDNMPE 440

  Fly   492 DFSAR--FERVQRAAPDERLTTIALISNLAY--------WNHKHPNISRLTFVRQPIYMYHLVIY 546
            .:..|  |                   ||:|        |   .....:.|..::|::.:...:.
  Fly   441 CYELRDAF-------------------NLSYNYVVTGDRW---RSYAEQQTLFKEPVFYFARDLC 483

  Fly   547 FPRRFFLRPAIDRKI--KQLLSAGVMAHIERRYMQY-----------------ENKRKVASNDPV 592
            |.|..||...:.|.:  :.|....:|...|..::.|                 ::..:..:..|.
  Fly   484 FSRLIFLSVPLRRHLPYRHLFDEHMMQQHEFGFVNYWMSHSFFDMVRLGLTSLKDLSRPLAYTPS 548

  Fly   593 LLRRITKSIMNGAYRIHGLVIVLATGMFILELLAGRSNGRLRRWMEW 639
            ||......||    :|:...|||....|:||:    ...:.:|||::
  Fly   549 LLMDDISWIM----KIYLAAIVLCVFCFLLEI----GVDKWKRWMKF 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 9/49 (18%)
Ir52bNP_725469.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.