DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and gria2a

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:XP_005170953.1 Gene:gria2a / 170450 ZFINID:ZDB-GENE-020125-3 Length:893 Species:Danio rerio


Alignment Length:545 Identity:93/545 - (17%)
Similarity:178/545 - (32%) Gaps:174/545 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 DGTVGTYSYKLFKANCTPGITVRQI-----------NHFDRITGKPQQSMPDLYPVRNGHLGDCP 240
            ||..|...:..:.......:.|.::           |..|::.    .:..||:|.....:.:..
Zfish   348 DGLTGNIQFDQYGRRVNYTVNVMELKNSGPVKIGYWNEMDKMA----VTKSDLFPNDTMGMENKT 408

  Fly   241 FNVGAAHMPPHLIYKRHKDPPPASNVSIPAEDLAGIDWDLLQLLAKALKFRIQLYMPQEPSQIFG 305
            ..|......|:::.|::      :.:....|...|...||...:||...|:.||       :|..
Zfish   409 VIVTTILEAPYVMLKKN------AELFTDNERYEGYCVDLAAEIAKHCGFKYQL-------RIVA 460

  Fly   306 EGNV----------SGCFRQLADGTVSIAIGGLSGSDKRRSLFSKSTVYHQSNFVMVVRRDRYLG 360
            :|..          :|...:|..|...||:..|:.:..|..:...|..:......:::::.:   
Zfish   461 DGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQ--- 522

  Fly   361 RLGPLIL----PFRGKLW--------GVIIVILLLAVLSTC-WLR-----SRLGLSHPIEDL--- 404
            :..|.:.    |...::|        ||.:|:.|::..|.. |..     .:||.|....:.   
Zfish   523 KSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGQLGPSESTNEFGIF 587

  Fly   405 ------LTVIV--GNPIPDHRLPGKGFLRYLLASWMLLTLVLRCAYQARLFDVLRLSRH-RPL-- 458
                  |...:  |..|....|.|    |.:...|...||::..:|.|.|...|.:.|. .|:  
Zfish   588 NSLWFSLGAFMQQGCDISPRSLSG----RIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIES 648

  Fly   459 PKDLSGLIKDNY-TMVANGYHDFYPLELTCRQPLDFSARFERVQRAAPDERLTTIALISNL-AYW 521
            .:||:...:..| |:.|....:|:                          |.:.|||...: .|.
Zfish   649 AEDLAKQTEIAYGTLDAGSTKEFF--------------------------RRSKIALFDKMWQYM 687

  Fly   522 NHKHPNISRLTFVRQPI------------YMYHLV----------------------------IY 546
            ....|::    ||:..:            |.|.|.                            |.
Zfish   688 KSAEPSV----FVKNTVEGVLRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIA 748

  Fly   547 FPRRFFLRPAIDRKIKQLLSAGVMAHIERRYMQY----------ENKRKVASNDPVLLRRITKSI 601
            .|:...||.|::..:.:|...|::..::.::. |          |:|.|.::          .|:
Zfish   749 TPKGSALRNAVNLAVLKLNEQGLLDKLKNKWW-YDKGECGSGGGESKEKTSA----------LSL 802

  Fly   602 MNGAYRIHGLVIVLATGMFILELLA 626
            .|    :.|:..:|..|:.:..|:|
Zfish   803 SN----VAGVFYILVGGLGLAMLVA 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 9/59 (15%)
gria2aXP_005170953.1 Periplasmic_Binding_Protein_Type_1 23..391 CDD:299141 6/46 (13%)
ANF_receptor 51..373 CDD:279440 4/24 (17%)
PBP2_iGluR_AMPA 406..783 CDD:270433 74/427 (17%)
Lig_chan 538..816 CDD:278489 57/326 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.