DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir11a and Grik3

DIOPT Version :9

Sequence 1:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_001074566.1 Gene:Grik3 / 14807 MGIID:95816 Length:919 Species:Mus musculus


Alignment Length:439 Identity:89/439 - (20%)
Similarity:154/439 - (35%) Gaps:133/439 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 DLLQLLAKALKFRIQLYMPQEPSQIFG----EGNVSGCFRQLADGTVSIAIGGLSGSDKRRSL-- 337
            |||:.||..|.|..::.:.::..  :|    :|..:|..::|.|....:|:..|:.:..|...  
Mouse   468 DLLKELAHILGFSYEIRLVEDGK--YGAQDDKGQWNGMVKELIDHKADLAVAPLTITHVREKAID 530

  Fly   338 FSK-------STVYHQSNFVMVVRRDRYLGRLGPLILPFRGKL----W--------GVIIVILLL 383
            |||       |.:|.:.|            ...|.:..|...|    |        ||..|:.::
Mouse   531 FSKPFMTLGVSILYRKPN------------GTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVI 583

  Fly   384 AVLSTC-WLRSRLGLSHP-------IEDLLTVI------VGNPIP--DHRLPGKGFLRYLLASWM 432
            |..|.. |..     :||       :|:..|::      :|:.:.  ...:|.....|.:...|.
Mouse   584 ARFSPYEWYD-----AHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWW 643

  Fly   433 LLTLVLRCAYQARLFDVLRLSR-HRPLPK--DLS-------GLIKDNYTMVANGYHDFYPLE--- 484
            ..||::..:|.|.|...|.:.| ..|:..  ||:       |.:||..||...........|   
Mouse   644 FFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMW 708

  Fly   485 --LTCRQPLDFSARFERVQRAAPDERLTT-IALI---SNLAYWNHKHPNISRL------------ 531
              ::.:.........|.:||.     ||. .||:   :.:.|...::.|::::            
Mouse   709 AFMSSKPSALVKNNEEGIQRT-----LTADYALLMESTTIEYITQRNCNLTQIGGLIDSKGYGIG 768

  Fly   532 TFVRQPIYMYHLVIYFPRRFFLRPAIDRKIKQLLSAGVMAHIERRYM------QYENKRKVASND 590
            |.:..|               .|..|...|.||.....:..::.::.      :.|||...|.  
Mouse   769 TPMGSP---------------YRDKITIAILQLQEEDKLHIMKEKWWRGSGCPEEENKEASAL-- 816

  Fly   591 PVLLRRITKSIMNGAYRIHGLVIVLATGMFILELLA-GRSNGRLRRWME 638
                         |..:|.|:.||||.|:.:..|:| |....:||:..|
Mouse   817 -------------GIQKIGGIFIVLAAGLVLSVLVAVGEFIYKLRKTAE 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 13/58 (22%)
Grik3NP_001074566.1 PBP1_iGluR_Kainate_GluR5_7 34..417 CDD:107388
PBP2_iGluR_Kainate_GluR7 433..801 CDD:270441 71/371 (19%)
Glutamate binding. /evidence=ECO:0000250 690..692 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.