DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Csnk1a1

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_006526446.1 Gene:Csnk1a1 / 93687 MGIID:1934950 Length:374 Species:Mus musculus


Alignment Length:358 Identity:193/358 - (53%)
Similarity:246/358 - (68%) Gaps:36/358 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYF 79
            |.||:|||||.||||||||.|.|.:||.||:|:||.|.|||||.||.::|:.|:...|:|.||::
Mouse    15 GKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWY 79

  Fly    80 HKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLM 144
            .:|:.|..:||||||||||.||.||.|.||:||||:||:||:.|:||||.:.|:|||||||||||
Mouse    80 GQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLM 144

  Fly   145 GLG------------------TMS----------KQVYLIDFGLSKKYLDITTGVHIPYREERSL 181
            |:|                  |:|          .|::||||||:|||.|..|..||||||:::|
Mouse   145 GIGRHCNKCLESPVGKRKRSMTVSPSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHIPYREDKNL 209

  Fly   182 TGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIE 246
            |||||||||.||.|:|.:|||||.::|||||||||.|||||.|||:||:||||:|.|||:|..:|
Mouse   210 TGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVE 274

  Fly   247 VLCEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDWDMLMMK-FHNTQK 310
            |||:|||.||.||||||||:.|.:.|:|.::.::||:|...||.:....:||.||..| ......
Mouse   275 VLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAAS 339

  Fly   311 NPGIGMRVFPPKQKEDD----GISGEPIIKDEK 339
            :.|.|.:...|..|:.|    .:.|   |||||
Mouse   340 SSGQGQQAQTPTGKQTDKTKSNMKG---IKDEK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 171/292 (59%)
SPS1 16..>242 CDD:223589 150/253 (59%)
Csnk1a1XP_006526446.1 STKc_CK1_alpha 16..309 CDD:271030 171/292 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849721
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.