DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and TTBK1

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_016866853.1 Gene:TTBK1 / 84630 HGNCID:19140 Length:1409 Species:Homo sapiens


Alignment Length:351 Identity:110/351 - (31%)
Similarity:176/351 - (50%) Gaps:45/351 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYFHK 81
            :||::|||.|.||:||..:.:.:.|.||:||||::.....|..|..:.:.|:....:.|.....:
Human    34 WKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGR 98

  Fly    82 EEHYQAMVMDLLGPSLERLFQFCER-AFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMG 145
            .|.:..:||.|.|.:|..|.:...| .||:.|.|.|.:|:|..:|.:|:.|||||||||.||.||
Human    99 NEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMG 163

  Fly   146 -LGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGY 209
             |.:..::.|::||||:::|.: |||...|.|......||.||||:.||...|..|.||:.::.|
Human   164 RLPSTYRKCYMLDFGLARQYTN-TTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFY 227

  Fly   210 VLMYFNRGSLPWQDLKASTK----QQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYD 270
            :|:.|..|.|||:.:|...:    ::|||.          .:|.:..|.||.::|::...:.::.
Human   228 MLVEFAVGQLPWRKIKDKEQVGMIKEKYEH----------RMLLKHMPSEFHLFLDHIASLDYFT 282

  Fly   271 KPNYDFICRMFRMLRNGLNLRPGLIYDW-----DMLMMKFHNT--QKN----------------P 312
            ||:|..|..:|........:.....:||     |.|:....:|  |:|                |
Human   283 KPDYQLIMSVFENSMKERGIAENEAFDWEKAGTDALLSTSTSTPPQQNTRQTAAMFGVVNVTPVP 347

  Fly   313 GIGMRVFPPKQKEDDGISGEPIIKDE 338
            |..:|     :..:|.:.||.:...|
Human   348 GDLLR-----ENTEDVLQGEHLSDQE 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 95/269 (35%)
SPS1 16..>242 CDD:223589 86/230 (37%)
TTBK1XP_016866853.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.