DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and CKL13

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_171939.1 Gene:CKL13 / 839520 AraportID:AT1G04440 Length:468 Species:Arabidopsis thaliana


Alignment Length:338 Identity:166/338 - (49%)
Similarity:232/338 - (68%) Gaps:15/338 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYF 79
            |.:|:.||:|.||||:|:||:.:.:||.||:|:|..:.|||||:||.::|..|:...|:|.:::|
plant     7 GKFKLGRKLGSGSFGEIFLGVNVQTGEEVAVKLEPLRARHPQLHYESKLYMLLQGGTGIPHLKWF 71

  Fly    80 HKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLM 144
            ..|..:..||:||||||:|..|.:|.|:|::||||:||:||:.||||:|.:||||||||||||||
plant    72 GVEGEFNCMVIDLLGPSMEEFFNYCSRSFSLKTVLMLADQMINRVEYMHVKGFLHRDIKPDNFLM 136

  Fly   145 GLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGY 209
            |||..:.|||:||:||:|||.|:.|..||||||.::|||||||||:..|.|:|.:||||:.::||
plant   137 GLGRKANQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLESLGY 201

  Fly   210 VLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNY 274
            :||||.|||||||.|:|.||:|||::|.|||....:||||:.||.|||.|..|.|.:.|.|||:|
plant   202 LLMYFLRGSLPWQGLRAGTKKQKYDKISEKKRLTPVEVLCKNFPPEFTSYFLYVRSLRFEDKPDY 266

  Fly   275 DFICRMFR--MLRNGLNLRPGLIYDWDML------MMKFHNTQKNPGI--GMRVFPPKQKEDDGI 329
            .::.|:||  .:|.|...  ..::||.:|      .....|::..|.:  .|.:..|..   |..
plant   267 SYLKRLFRDLFIREGYQF--DYVFDWTILRYPQFGSSSSSNSKPRPTLRPAMNIPVPSA---DKA 326

  Fly   330 SGEPIIKDEKCNF 342
            ...||.:|.:..|
plant   327 EKPPIGQDSRERF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 149/264 (56%)
SPS1 16..>242 CDD:223589 131/225 (58%)
CKL13NP_171939.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 152/273 (56%)
Pkinase 9..241 CDD:278497 133/231 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.