DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and ADK1

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_563695.2 Gene:ADK1 / 839368 AraportID:AT1G03930 Length:471 Species:Arabidopsis thaliana


Alignment Length:330 Identity:173/330 - (52%)
Similarity:230/330 - (69%) Gaps:20/330 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYF 79
            |.:|:.||||.||||::||||.:.:||.||:|:||.|.:||||:||.::|..|:...|:|.::::
plant     7 GKFKLGRKIGSGSFGELYLGINVQTGEEVAVKLESVKTKHPQLHYESKLYMLLQGGTGVPNLKWY 71

  Fly    80 HKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLM 144
            ..|..|..||:||||||||.||.:|.|..::||||:||:|::.|||::|.|||||||||||||||
plant    72 GVEGDYNVMVIDLLGPSLEDLFNYCNRKLSLKTVLMLADQLINRVEFMHTRGFLHRDIKPDNFLM 136

  Fly   145 GLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGY 209
            |||..:.|||:|||||.|||.|:.|..||||||.::|||||||||:..|.|||.:||||:.|:||
plant   137 GLGRKANQVYIIDFGLGKKYRDLQTHRHIPYRENKNLTGTARYASVNTHLGVEQSRRDDLEALGY 201

  Fly   210 VLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNY 274
            |||||.:||||||.|||.||:|||:||.|||::..|||||:..|.||..|..|||.:.|.|||:|
plant   202 VLMYFLKGSLPWQGLKAGTKKQKYDRISEKKVATPIEVLCKNQPSEFVSYFRYCRSLRFDDKPDY 266

  Fly   275 DFICRMFR--MLRNGLNLRPGLIYDWDMLMMKF--------------HNTQKNPGIGMRVFPPKQ 323
            .::.|:||  .:|.|...  ..::||.:|  |:              ::|..|||:.......||
plant   267 SYLKRLFRDLFIREGYQF--DYVFDWTVL--KYPQIGSSSGSSSRTRNHTTANPGLTAGASLEKQ 327

  Fly   324 KEDDG 328
            :...|
plant   328 ERIAG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 157/264 (59%)
SPS1 16..>242 CDD:223589 139/225 (62%)
ADK1NP_563695.2 STKc_CK1_delta_epsilon 8..282 CDD:271027 160/273 (59%)
SPS1 8..>277 CDD:223589 159/268 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.