DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and ckl12

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_680447.1 Gene:ckl12 / 835804 AraportID:AT5G57015 Length:435 Species:Arabidopsis thaliana


Alignment Length:335 Identity:179/335 - (53%)
Similarity:235/335 - (70%) Gaps:17/335 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EVRIGN-YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLP 74
            |.|:|| |::.||||.||||:||||.:|.:.|.||||:|:.|.:||||.||.::||.|:...|:|
plant     2 EPRVGNKYRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRILQGGTGVP 66

  Fly    75 RIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKP 139
            .|::|..|..|..:||||||||||.||.||.|..::|:||:||:||:.||||.|::.|||||:||
plant    67 NIKWFGVEGDYNTLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFHSKSFLHRDLKP 131

  Fly   140 DNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDM 204
            ||||||||..:.||::|||||:|||.|.||..||||||.::|||||||||:..|.|:|.:||||:
plant   132 DNFLMGLGRRANQVHIIDFGLAKKYRDNTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDL 196

  Fly   205 VAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFY 269
            .::||:||||.:||||||.|||.||:||||||.|||:|.|||.||.|:|.||..|.:|||.:.|.
plant   197 ESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIESLCRGYPSEFASYFHYCRSLRFD 261

  Fly   270 DKPNYDFICRMFR--MLRNGLNLRPGLIYDWDMLMMKFHNTQ---------KNPGIGMRV-FPPK 322
            |||:|.::.|:||  .:|.|...  ..::||.:|  |:..:|         .:|.:|... .||.
plant   262 DKPDYGYLKRIFRDLFIREGFQF--DYVFDWTIL--KYQQSQLTAPPSRGLVSPAVGTSAGLPPG 322

  Fly   323 QKEDDGISGE 332
            ....|...||
plant   323 LTSIDRYGGE 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 160/265 (60%)
SPS1 16..>242 CDD:223589 140/226 (62%)
ckl12NP_680447.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 162/273 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.