DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and ckl7

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001330873.1 Gene:ckl7 / 834433 AraportID:AT5G44100 Length:476 Species:Arabidopsis thaliana


Alignment Length:341 Identity:174/341 - (51%)
Similarity:232/341 - (68%) Gaps:35/341 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYF 79
            |.:|:.:|||.||||::|||:.:.:||.||:|:|:.|.:||||:||.::|..|:...|:|.|::|
plant     7 GKFKLGKKIGSGSFGELYLGVNVQTGEEVAVKLENVKTKHPQLHYESKLYMLLQGGSGIPNIKWF 71

  Fly    80 HKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLM 144
            ..|..|..||:||||||||.||.:|.|..|:||||:||:|:|.|||::|.|||||||||||||||
plant    72 GVEGDYSVMVIDLLGPSLEDLFNYCNRKLTLKTVLMLADQLLNRVEFMHTRGFLHRDIKPDNFLM 136

  Fly   145 GLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGY 209
            |||..:.|||:|||||.|||.|:.|..||||||.::|||||||||:..|.|||.:||||:.::||
plant   137 GLGRKANQVYIIDFGLGKKYRDLQTHKHIPYRENKNLTGTARYASVNTHLGVEQSRRDDLESLGY 201

  Fly   210 VLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNY 274
            |||||.:||||||.|||.||:|||:||.|||:|..|||||:..|.||..|.:|||.:.|.|||:|
plant   202 VLMYFLKGSLPWQGLKAGTKKQKYDRISEKKVSTPIEVLCKNQPSEFVSYFHYCRSLRFDDKPDY 266

  Fly   275 DFICRMFR--MLRNGLNLRPGLIYDWDMLMMKF--------------HNTQKNPGIGMRVFPPKQ 323
            .::.|:||  .:|.|...  ..::||.:|  |:              |:|...|           
plant   267 SYLKRLFRDLFIREGYQF--DYVFDWTVL--KYPQIGSSSGSSSRTRHHTTAKP----------- 316

  Fly   324 KEDDGISGEPIIKDEK 339
                |.:.:||.:.|:
plant   317 ----GFNADPIERQER 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 158/264 (60%)
SPS1 16..>242 CDD:223589 139/225 (62%)
ckl7NP_001330873.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 161/273 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.