DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and ckl7

DIOPT Version :10

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_199223.1 Gene:ckl7 / 834433 AraportID:AT5G44100 Length:476 Species:Arabidopsis thaliana


Alignment Length:141 Identity:28/141 - (19%)
Similarity:53/141 - (37%) Gaps:30/141 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DALHLAHLIASHGYLFQIDDHVLT--VKNDGTFYRFQTPYFWPSNCWDPENTDYAVYLCKRTMQN 139
            ||....:.:...|.|..|..||.|  :|.........:|||            :|::..:.:...
plant    25 DAFVCMNRMRQRGLLCDIVLHVGTKEIKGHKVVLASCSPYF------------HAMFTNEMSESR 77

  Fly   140 KAHLELEDFEAENLAKLQKMFSRKWEFV--------FMQAEAQYKVDKKRDRQERQILDSQE--- 193
            :.|:.|.|.:.:.|.:|.: ::...|.|        .:.|.:..:::..||...:.:|...:   
plant    78 QTHVTLHDIDPQALEQLVQ-YAYTAEIVVGEGNVQTLLPAASLLQLNGVRDACCKFLLSQLDPSN 141

  Fly   194 ----RAFWDVH 200
                |.|.|.|
plant   142 CLGIRGFADTH 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 28/141 (20%)
ckl7NP_199223.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 28/141 (20%)

Return to query results.
Submit another query.