DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and ckl3

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001329054.1 Gene:ckl3 / 829009 AraportID:AT4G28880 Length:415 Species:Arabidopsis thaliana


Alignment Length:313 Identity:170/313 - (54%)
Similarity:223/313 - (71%) Gaps:14/313 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERLRSSQNREVRIGNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYR 65
            |||:..        |.||:.||||.||||:|:|..::.:.|.||:|:|:||.:||||.||.::||
plant     1 MERIIG--------GKYKLGRKIGGGSFGEIFLATHVDTFEIVAVKIENSKTKHPQLLYEAKLYR 57

  Fly    66 ALRPAHGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNR 130
            .|....|:|||::|..:....|:||||||||||.||.:|.|.|:.||||:||:|||.|:|:||::
plant    58 ILEGGSGIPRIKWFGVDGTENALVMDLLGPSLEDLFVYCGRKFSPKTVLMLADQMLTRIEFVHSK 122

  Fly   131 GFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAG 195
            |:|||||||||||||||..:.|||||||||:|:|.|..|..||||||.::|||||||||...|.|
plant   123 GYLHRDIKPDNFLMGLGRKANQVYLIDFGLAKRYRDANTNRHIPYRENKNLTGTARYASCNTHLG 187

  Fly   196 VESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYL 260
            :|.:||||:.::||||:||.|||||||.|||..|:|||::|.|||||..|||||:..|.||..|.
plant   188 IEQSRRDDLESLGYVLLYFLRGSLPWQGLKAVDKKQKYDKICEKKISTPIEVLCKNHPVEFASYF 252

  Fly   261 NYCRGMGFYDKPNYDFICRMFRML--RNGLNLRPGLIYDWDMLMMKFHNTQKN 311
            :||..:.|..:|:|.|:.|:||.|  |.|...  ..|:||.::  |:...||:
plant   253 HYCHTLTFDQRPDYGFLKRLFRDLFSREGYEF--DYIFDWTII--KYQQAQKS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 155/264 (59%)
SPS1 16..>242 CDD:223589 137/225 (61%)
ckl3NP_001329054.1 PKc_like 8..282 CDD:419665 159/273 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.