DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and ckl4

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_194615.2 Gene:ckl4 / 829007 AraportID:AT4G28860 Length:414 Species:Arabidopsis thaliana


Alignment Length:350 Identity:183/350 - (52%)
Similarity:232/350 - (66%) Gaps:25/350 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERLRSSQNREVRIGNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYR 65
            |||:..        |.||:.||||.||||:|:|..:|.:.|.||:|:|:||.:||||.||.::||
plant     1 MERIIG--------GKYKLGRKIGGGSFGEIFLATHIDTFEIVAVKIENSKTKHPQLLYEAKLYR 57

  Fly    66 ALRPAHGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNR 130
            .|....|:||||:|..:....|:||||||||||.||.:|.|.|:.||||:||:|||.|:||||::
plant    58 TLEGGSGIPRIRWFGVDGTENALVMDLLGPSLEDLFVYCGRKFSPKTVLMLADQMLTRIEYVHSK 122

  Fly   131 GFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAG 195
            |:|||||||||||||||..:.|||||||||:|:|.|..|..||||||.::|||||||||...|.|
plant   123 GYLHRDIKPDNFLMGLGRKANQVYLIDFGLAKRYRDANTNRHIPYRENKNLTGTARYASCNTHLG 187

  Fly   196 VESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYL 260
            :|..||||:.::||||:||.|||||||.|||..|:|||::|.|||||..|||||:..|.||..|.
plant   188 IEQGRRDDLESLGYVLLYFLRGSLPWQGLKAVDKKQKYDKICEKKISTPIEVLCKSHPVEFASYF 252

  Fly   261 NYCRGMGFYDKPNYDFICRMFRML--RNGLNLRPGLIYDWDMLMMKFHNTQKN-------PG-IG 315
            :||..:.|..:|:|.|:.|:||.|  |.|...  ..||||.::  |:..:||.       || ..
plant   253 HYCHTLTFDQRPDYGFLKRLFRDLFSREGYEF--DYIYDWTII--KYQQSQKTRSQSQAVPGSSN 313

  Fly   316 MRVFPPKQKEDDG---ISGEPIIKD 337
            .|..|.......|   ||.|..:.|
plant   314 ARAIPMDTSNHRGGTKISHEAQVSD 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 158/264 (60%)
SPS1 16..>242 CDD:223589 140/225 (62%)
ckl4NP_194615.2 PKc_like 8..282 CDD:419665 162/273 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.