DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and AT4G08800

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_192620.1 Gene:AT4G08800 / 826451 AraportID:AT4G08800 Length:285 Species:Arabidopsis thaliana


Alignment Length:315 Identity:150/315 - (47%)
Similarity:203/315 - (64%) Gaps:49/315 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EVRIGN-YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLP 74
            |:|||| :::.||||.|:||:||||..:.|.|.||||.||.|..||||.||.||||.|:..:|:|
plant     2 ELRIGNKFRLGRKIGSGAFGEIYLGTDVQSNEDVAIKFESVKTVHPQLAYESRIYRVLQSGNGIP 66

  Fly    75 RIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKP 139
            .::::.|                          |::||||:||:||:.|:|::|::.||||||||
plant    67 NMKWYGK--------------------------FSLKTVLMLADQMINRLEFIHSKSFLHRDIKP 105

  Fly   140 DNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDM 204
            ||||||....|      ||||::||.|.::..||||||.:|||||..|||:..|.|:|.:||||:
plant   106 DNFLMGKAGKS------DFGLARKYRDSSSYRHIPYRENKSLTGTPAYASLNTHLGIEQSRRDDV 164

  Fly   205 VAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFY 269
            .::||:||||.:|||||:.|||..|:|||::|.|||:|.|||.||||.|.||..|::|||.:.|.
plant   165 ESLGYILMYFLKGSLPWKGLKAGNKKQKYDKISEKKVSTSIETLCEGHPIEFATYIHYCRSLRFD 229

  Fly   270 DKPNYDFICRMFR--MLRNGLNLRPGLIYDWDMLMMKFHNTQKNPGIGMRVFPPK 322
            |||:|.::.|:||  .:|.|...  ..::||.:|        |.|.|.|    ||
plant   230 DKPDYAYLKRLFRDLFIREGFQF--DFVFDWTVL--------KLPAITM----PK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 133/265 (50%)
SPS1 16..>242 CDD:223589 112/226 (50%)
AT4G08800NP_192620.1 PKc_like 8..250 CDD:304357 135/273 (49%)
SPS1 8..>205 CDD:223589 112/228 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.