DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and ckl10

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_188976.1 Gene:ckl10 / 821915 AraportID:AT3G23340 Length:442 Species:Arabidopsis thaliana


Alignment Length:327 Identity:172/327 - (52%)
Similarity:233/327 - (71%) Gaps:12/327 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYF 79
            |.:|:.||||.||||::|:||.:.:||.||:|:|..|.:||||:||.::|..|:...|:|.|::|
plant     7 GKFKLGRKIGSGSFGELYIGINVQTGEEVALKLEPVKTKHPQLHYESKVYMLLQGGTGVPHIKWF 71

  Fly    80 HKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLM 144
            ..|.:|..|.:||||||||.||.:|.|:|::||||:||:|::.||||:|:|||||||||||||||
plant    72 GVEGNYNCMAIDLLGPSLEDLFNYCTRSFSLKTVLMLADQLINRVEYMHSRGFLHRDIKPDNFLM 136

  Fly   145 GLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGY 209
            |||..:.|||:||:||:|||.|:.|..||||||.::|||||||||:..|.|:|.:||||:.::||
plant   137 GLGRKANQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLESLGY 201

  Fly   210 VLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNY 274
            |||||.|||||||.|||.||:||||:|.|||:...:||||:.:|.|||.|.:|||.:.|.|||:|
plant   202 VLMYFIRGSLPWQGLKAGTKKQKYEKISEKKMLTPVEVLCKSYPSEFTSYFHYCRSLRFEDKPDY 266

  Fly   275 DFICRMFR--MLRNGLNLRPGLIYDWDMLMMKFHNTQKNPGIGMRVFPPKQKEDDGISGE----P 333
            .::.|:||  .:|.|...  ..::||.:|......:...|    |..|....:..|.|.|    |
plant   267 SYLKRLFRDLFIREGYQF--DYVFDWTILKYPQSGSISKP----RPNPKPALDPPGPSAERNEKP 325

  Fly   334 II 335
            |:
plant   326 IV 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 156/264 (59%)
SPS1 16..>242 CDD:223589 138/225 (61%)
ckl10NP_188976.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 159/273 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.