DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and AT3G13670

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_187977.1 Gene:AT3G13670 / 820572 AraportID:AT3G13670 Length:703 Species:Arabidopsis thaliana


Alignment Length:299 Identity:103/299 - (34%)
Similarity:170/299 - (56%) Gaps:21/299 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRIGN---YKVVRKIGCGSFGDIYLGIYIHSGE---------RVAIKVE--SSKVRHPQLNYERR 62
            |::|.   |||.||:|.|.||.:::|..|..|.         .||:|.|  |||..:....:|.:
plant   129 VQVGGSPLYKVERKLGKGGFGQVFVGRRISGGNDRSAGASILEVALKFEHRSSKGCNYGPPHEWQ 193

  Fly    63 IYRALRPAHGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYV 127
            :|..|..:||:||:.:..::..|..||||:|||||..|:....:|.:.:.|..:|.:.|..:|.:
plant   194 VYNTLGGSHGVPRVHFKGRQGDYYVMVMDMLGPSLWDLWNTSGQAMSSEMVACIAVESLSILEKM 258

  Fly   128 HNRGFLHRDIKPDNFLMGLGTMS--KQVYLIDFGLSKKYLDITTGVHIPYREERSL-TGTARYAS 189
            |.:|::|.|:||:|||:|..:.|  |:::|:|.||:.|:.:..:|.|:.|.:...: .||.||||
plant   259 HAKGYVHGDVKPENFLLGQPSTSQEKKLFLVDLGLATKWREGGSGQHVEYDQRPDMFRGTVRYAS 323

  Fly   190 IGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPC 254
            ..||.|..::||||:.::.|.|::.:||.||||..:...|.   ..:.:||::.|.::||...|.
plant   324 AHAHLGRTASRRDDLESLAYTLIFLHRGRLPWQGYQGDNKS---FLVCKKKMATSPDMLCCFCPP 385

  Fly   255 EFTMYLNYCRGMGFYDKPNYDFICRMFR-MLRNGLNLRP 292
            .|..:|.....|.|.::|||..:..:|: :|.....:||
plant   386 PFKQFLEIVVNMKFDEEPNYGKLVSLFQDLLGENPAIRP 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 97/281 (35%)
SPS1 16..>242 CDD:223589 86/242 (36%)
AT3G13670NP_187977.1 STKc_CK1 137..412 CDD:270918 97/277 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.