DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and AT3G03940

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_187044.1 Gene:AT3G03940 / 819551 AraportID:AT3G03940 Length:701 Species:Arabidopsis thaliana


Alignment Length:289 Identity:99/289 - (34%)
Similarity:162/289 - (56%) Gaps:19/289 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRIGN---YKVVRKIGCGSFGDIYLGIYIHSGE--------RVAIKVE--SSKVRHPQLNYERRI 63
            |::||   ||..||:|.|.||.:|:|..:..|.        .||:|:|  :||..:....||.::
plant   132 VQVGNSPVYKTERKLGKGGFGQVYVGRRVSGGSDRIGADAIEVALKLEHRNSKGCNFGPPYEWQV 196

  Fly    64 YRALRPAHGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVH 128
            |..|...:|:|.:.:..::..:..:|||:|||||..::....::.:...|..:|.:.:..:|.:|
plant   197 YNTLNSCYGIPAVHHKGRQGDFYILVMDMLGPSLWDVWNSLAQSMSPNMVACIAVEAISILEKLH 261

  Fly   129 NRGFLHRDIKPDNFLMGL-GTM-SKQVYLIDFGLSKKYLDITTGVHIPYREERSL-TGTARYASI 190
            .:||:|.|:||:|||:|. ||. .|::||||.||:.::.|..:|.|:.|.:...: .||.||||.
plant   262 MKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWKDSHSGQHVEYDQRPDVFRGTIRYASC 326

  Fly   191 GAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCE 255
            .||.|...:||||:.::.|.|::..||.||||..:...|.   ..:.:||:|.|.|::|...|..
plant   327 HAHLGRTGSRRDDLESLAYTLIFLMRGRLPWQGYQGDNKS---FLVCKKKMSTSPELMCCFCPPP 388

  Fly   256 FTMYLNYCRGMGFYDKPNYDFICRMFRML 284
            |.::|.....|.|.::|||..:..:|..|
plant   389 FKLFLEAVTNMKFDEEPNYAKLISIFDTL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 95/280 (34%)
SPS1 16..>242 CDD:223589 83/241 (34%)
AT3G03940NP_187044.1 STKc_CK1 140..414 CDD:270918 94/276 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.