DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and VRK2

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001123952.1 Gene:VRK2 / 7444 HGNCID:12719 Length:508 Species:Homo sapiens


Alignment Length:317 Identity:94/317 - (29%)
Similarity:140/317 - (44%) Gaps:59/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GNYKVV-RKIGCGSFGDIYLGIYIHSGERVA---IKVESSK-----------------------V 52
            ||..|: :|||.|.||.|||....:..|:.|   :|||..:                       :
Human    26 GNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWI 90

  Fly    53 RHPQLNYERRIYRALRPAHGLPRIRYFH-------KEEHYQAMVMDLLGPSLERLFQFCERAFTI 110
            ...||:|           .|:|   .|:       |...|:.|||:.||..|::: ......|..
Human    91 ERKQLDY-----------LGIP---LFYGSGLTEFKGRSYRFMVMERLGIDLQKI-SGQNGTFKK 140

  Fly   111 KTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPY 175
            .|||.|..:||..:||:|...::|.|||..|.|:|... ..||||.|:|||.:|  ...|.|..|
Human   141 STVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKN-PDQVYLADYGLSYRY--CPNGNHKQY 202

  Fly   176 RE--ERSLTGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPW-QDLK--ASTKQQKYER 235
            :|  .:...||..:.|:.||.||..:||.|:..:||.::.:..|.||| |:||  .:.:..|...
Human   203 QENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNL 267

  Fly   236 IHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRP 292
            :.|...||..........||...:|.....:.:.:||||..:.::..  .:|:.|.|
Human   268 LDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILN--PHGIPLGP 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 90/303 (30%)
SPS1 16..>242 CDD:223589 81/264 (31%)
VRK2NP_001123952.1 STKc_VRK2 16..314 CDD:271025 91/305 (30%)
SPS1 29..421 CDD:223589 92/314 (29%)
Interaction with MAP3K7. /evidence=ECO:0000269|PubMed:17709393 397..508
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.