DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Csnk1g2

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_006241063.1 Gene:Csnk1g2 / 65278 RGDID:621407 Length:441 Species:Rattus norvegicus


Alignment Length:312 Identity:142/312 - (45%)
Similarity:205/312 - (65%) Gaps:32/312 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRP----------- 69
            |::|.:|||||:||::.||..:::.|.||||:|..|.|.|||:.|.|.|:.|..           
  Rat    45 NFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSTTGEDTGRGAAL 109

  Fly    70 ---------------AHGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQ 119
                           |.|:|::.||.....|.|||::|||||||.||..|:|.||:||||::|.|
  Rat   110 LGGQGLRTPSIDVSLAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQ 174

  Fly   120 MLRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQ--VYLIDFGLSKKYLDITTGVHIPYREERSLT 182
            ::.|:||||.:..::||:||:|||:|.....:|  :::|||||:|:|:|..|..||||||.:|||
  Rat   175 LITRMEYVHTKSLIYRDVKPENFLVGRPGSKRQHSIHIIDFGLAKEYIDPETKKHIPYREHKSLT 239

  Fly   183 GTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEV 247
            |||||.||..|.|.|.:||||:.|:|::.|||.|||||||.|||.|.:::|::|.:.|.:..|||
  Rat   240 GTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEV 304

  Fly   248 LCEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDWD 299
            |||.||.|...||.|.|.:.|::||:||::.::|..|.:    |.|.::|::
  Rat   305 LCESFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFD----RSGYVFDYE 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 137/292 (47%)
SPS1 16..>242 CDD:223589 119/253 (47%)
Csnk1g2XP_006241063.1 STKc_CK1_gamma 45..358 CDD:271028 142/312 (46%)
SPS1 45..>355 CDD:223589 142/312 (46%)
CK1gamma_C 358..400 CDD:289378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.