DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Csnk1g3

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_074046.1 Gene:Csnk1g3 / 64823 RGDID:621408 Length:448 Species:Rattus norvegicus


Alignment Length:297 Identity:145/297 - (48%)
Similarity:213/297 - (71%) Gaps:7/297 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSQNREVRIG-NYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRP 69
            ||.:..:.:| |::|.:|||||:||::.||..:::.|.||||:|..|.|.|||:.|.|.|:.|..
  Rat    31 SSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGS 95

  Fly    70 AHGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLH 134
            ..|:|::.||.....|.|||::|||||||.||..|:|.|::||||::|.|::.|:||||::..::
  Rat    96 GDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIY 160

  Fly   135 RDIKPDNFLMGL-GTMSKQV-YLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVE 197
            ||:||:|||:|. |..::|| ::|||||:|:|:|..|..||||||.:||||||||.||..|.|.|
  Rat   161 RDVKPENFLIGRPGNKAQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKE 225

  Fly   198 SARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNY 262
            .:||||:.|:|::.|||.|||||||.|||.|.:::|::|.:.|.:..||||||.||.|...||.|
  Rat   226 QSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRY 290

  Fly   263 CRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDWD 299
            .|.:.|::||:||::.::|..|.:    |.|.::|::
  Rat   291 VRRLDFFEKPDYDYLRKLFTDLFD----RKGYMFDYE 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 137/266 (52%)
SPS1 16..>242 CDD:223589 119/227 (52%)
Csnk1g3NP_074046.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 2/3 (67%)
STKc_CK1_gamma 42..329 CDD:271028 142/286 (50%)
CK1gamma_C 329..418 CDD:403712
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..375
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.