DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Csnk1d

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_038942724.1 Gene:Csnk1d / 64462 RGDID:71031 Length:428 Species:Rattus norvegicus


Alignment Length:296 Identity:175/296 - (59%)
Similarity:225/296 - (76%) Gaps:3/296 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EVRIGN-YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLP 74
            |:|:|| |::.||||.|||||||||..|.:||.||||:|..|.:||||:.|.:||:.::...|:|
  Rat     2 ELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIP 66

  Fly    75 RIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKP 139
            .||:...|..|..|||:|||||||.||.||.|.|::|||||||:||:.|:||:|::.|:|||:||
  Rat    67 TIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKP 131

  Fly   140 DNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDM 204
            ||||||||.....||:|||||:|||.|..|..||||||.::||||||||||..|.|:|.:||||:
  Rat   132 DNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 196

  Fly   205 VAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFY 269
            .::||||||||.||||||.|||:||:||||||.|||:|..|||||:|:|.||..|||:||.:.|.
  Rat   197 ESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFD 261

  Fly   270 DKPNYDFICRMFRMLRNGLNLRPGLIYDWDMLMMKF 305
            |||:|.::.::||.|.:........::||:||  ||
  Rat   262 DKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML--KF 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 163/265 (62%)
SPS1 16..>242 CDD:223589 143/226 (63%)
Csnk1dXP_038942724.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 165/273 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.