DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Csnk1g1

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_017451375.1 Gene:Csnk1g1 / 64086 RGDID:621404 Length:467 Species:Rattus norvegicus


Alignment Length:299 Identity:147/299 - (49%)
Similarity:207/299 - (69%) Gaps:8/299 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSQNREVRIG-NYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRP 69
            |:.:..:.:| |::|.:|||||:||::.||..:::.|.||||:|..|.|.|||:.|.|.|:.|..
  Rat    32 STSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGS 96

  Fly    70 A-HGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFL 133
            | .|||::.||.....|.|||::|||||||.||..|:|.||:||||::|.|:|.|:||||::..:
  Rat    97 AGEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLI 161

  Fly   134 HRDIKPDNFLMGLGTMSKQ--VYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGV 196
            :||:||:|||:|.....|:  :::|||||:|:|:|..|..||||||.:||||||||.||..|.|.
  Rat   162 YRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGK 226

  Fly   197 ESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLN 261
            |.:||||:.|:|::.|||.|||||||.|||.|.:::|::|.:.|.|..||.|||.||.|...||.
  Rat   227 EQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRSTPIEALCENFPEEMMTYLR 291

  Fly   262 YCRGMGFYDKPNYDFICRMFRML--RNGLNLRPGLIYDW 298
            |.|.:.|::||:|:::..:|..|  |.|...  ...|||
  Rat   292 YVRRLDFFEKPDYEYLRNLFTDLFERKGYTF--DYAYDW 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 138/267 (52%)
SPS1 16..>242 CDD:223589 121/228 (53%)
Csnk1g1XP_017451375.1 STKc_CK1_gamma 43..331 CDD:271028 145/288 (50%)
CK1gamma_C 331..429 CDD:403712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.