DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and ttbk2b

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001313220.1 Gene:ttbk2b / 569881 ZFINID:ZDB-GENE-030131-8246 Length:928 Species:Danio rerio


Alignment Length:351 Identity:100/351 - (28%)
Similarity:173/351 - (49%) Gaps:40/351 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YKVVRKIGCGSFGDIYLGIYIHSGE-RVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYFH 80
            ::|::|||.|.||:|| .:..|..: .||:||||::.....|..|..:.:.|:....:.|.....
Zfish    21 WRVLKKIGGGGFGEIY-EVLDHVNQVSVALKVESAQQPKQVLKMEVAVLKRLQGKDHVCRFVGCG 84

  Fly    81 KEEHYQAMVMDLLGPSLERLFQ-FCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLM 144
            :.:.:..:||:|.|.:|..|.: .....|::.|.|.|..|:|..:|.:|:.|||||||||.||.|
Zfish    85 RNDRFNYVVMELQGRNLADLRRNMSHGTFSVSTTLRLGRQILEAIESIHSVGFLHRDIKPSNFAM 149

  Fly   145 G-LGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVG 208
            | |.:..:..|::||||::::.:....|. |.|......||.|||||.||...|..|.||:.::.
Zfish   150 GRLNSTCRTCYMLDFGLARQFTNSCQEVR-PPRPVAGFRGTVRYASINAHKNKEMGRHDDLWSLF 213

  Fly   209 YVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPN 273
            |:|:.|..|.|||:.:|..      |::...|.:.:..:|.:..|.||:::.::...:.:|.||:
Zfish   214 YMLVEFMVGQLPWRKIKDK------EQVGNMKETYNHRLLLKHLPDEFSVFFDHISNLDYYTKPD 272

  Fly   274 YDFICRMFRMLRNGLNLRPGLIYDWDMLMMKFHNTQKNPGIG---------MRVFP--------- 320
            |..:..:|.......|:.....|||:.|     :::....:|         .|:.|         
Zfish   273 YQLLMSVFDNSMKSYNVVENDPYDWEKL-----DSEDTLNVGTLATTAQQLTRLTPAYLGMANAS 332

  Fly   321 ------PKQKEDDGISGEPIIKDEKC 340
                  .::..:|.:.||.:.:.:.|
Zfish   333 AIPGDLQRENTEDVLQGERLSEADNC 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 87/266 (33%)
SPS1 16..>242 CDD:223589 79/227 (35%)
ttbk2bNP_001313220.1 STKc_TTBK 20..281 CDD:270919 87/267 (33%)
SPS1 21..361 CDD:223589 100/351 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.