DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and VRK3

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_057524.3 Gene:VRK3 / 51231 HGNCID:18996 Length:474 Species:Homo sapiens


Alignment Length:281 Identity:67/281 - (23%)
Similarity:125/281 - (44%) Gaps:48/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QLNYERRIYRALRPAHGLPRIRYF--HKEEHYQAMVMDLLGPSLERLFQFC-ERAFTIKTVLLLA 117
            |:|..:::|..  |...:|....|  |::: |:.:|:..||.||:...... :...:.::||.:|
Human   226 QVNKWKKLYST--PLLAIPTCMGFGVHQDK-YRFLVLPSLGRSLQSALDVSPKHVLSERSVLQVA 287

  Fly   118 EQMLRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYRE-ERS- 180
            .::|..:|::|...::|.::..:|..:.....| ||.|..:|.:.:|  ..:|.|:.|.| .|| 
Human   288 CRLLDALEFLHENEYVHGNVTAENIFVDPEDQS-QVTLAGYGFAFRY--CPSGKHVAYVEGSRSP 349

  Fly   181 LTGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTK---QQKYERIHEKKIS 242
            ..|...:.|:..|.|...:||.|:.::||.::.:..|.|||.:...:|:   :||.:.:.:....
Human   350 HEGDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPWTNCLPNTEDIMKQKQKFVDKPGPF 414

  Fly   243 VSIEVLCEGFPC--------EFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDWD 299
            |.        ||        ....||.....:.:.:||.|       .||||.|          :
Human   415 VG--------PCGHWIRPSETLQKYLKVVMALTYEEKPPY-------AMLRNNL----------E 454

  Fly   300 MLMMKFHNTQKNPGIGMRVFP 320
            .|:.....:..:| ||:.:.|
Human   455 ALLQDLRVSPYDP-IGLPMVP 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 57/240 (24%)
SPS1 16..>242 CDD:223589 49/193 (25%)
VRK3NP_057524.3 zinc_ribbon_2 4..26 CDD:289981
DZR 5..>31 CDD:289539
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..152
Nuclear localization signal. /evidence=ECO:0000269|PubMed:14645249 49..64
DUF4551 <82..>150 CDD:291746
PKc_like 155..457 CDD:304357 62/261 (24%)
SPS1 211..>467 CDD:223589 63/271 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.