DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and gish

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster


Alignment Length:297 Identity:142/297 - (47%)
Similarity:205/297 - (69%) Gaps:20/297 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRAL-----RPAHGLPR 75
            |::|.:|||||:||::.||..:::.|.||||:|..|.:.|||:.|.|.|:.|     ....|:||
  Fly    61 NFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGIPR 125

  Fly    76 IRYFHKEE---HYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDI 137
            |  :|...   .|.|||::|||.|||.||..|.|.|::||||::|:|:|.|:||||:|..::||:
  Fly   126 I--YHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDV 188

  Fly   138 KPDNFLMGLGTMSKQ--VYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESAR 200
            ||:|||:|..:..::  :::|||||:|:|:|:.|..||||||.:||||||||.||..|.|.|.:|
  Fly   189 KPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSR 253

  Fly   201 RDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRG 265
            |||:.|:|::.|||.|||||||.|||.|.:::|::|.:.|.:..|||||:|.|.||..||.|.|.
  Fly   254 RDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRR 318

  Fly   266 MGFYDKPNYDFICRMFRMLRNGLNLRPGLI----YDW 298
            :.|::.|:|||:.|:|:.|.:    |.|..    :||
  Fly   319 LDFFETPDYDFLRRLFQDLFD----RKGYTDEGEFDW 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 136/274 (50%)
SPS1 16..>242 CDD:223589 117/235 (50%)
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 142/297 (48%)
S_TKc 62..335 CDD:214567 135/274 (49%)
CK1gamma_C 354..428 CDD:289378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452705
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.