DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and csnk1g1

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_031753667.1 Gene:csnk1g1 / 448124 XenbaseID:XB-GENE-488259 Length:460 Species:Xenopus tropicalis


Alignment Length:321 Identity:150/321 - (46%)
Similarity:212/321 - (66%) Gaps:26/321 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERLRSSQNREVRIG-------------------NYKVVRKIGCGSFGDIYLGIYIHSGERVAIKV 47
            ||.|.::...||.|                   |::|.:|||||:||::.||..:::.|.||||:
 Frog    10 ERPRPAKALPVRTGHSSRPSSSTTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKL 74

  Fly    48 ESSKVRHPQLNYERRIYRAL-RPAHGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIK 111
            |..|.|.|||:.|.|.|:.| ..|.|||::.||.....|.|||::|||||||.||..|:|.||:|
 Frog    75 EPIKSRAPQLHLEYRFYKQLGNTAEGLPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLK 139

  Fly   112 TVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQ--VYLIDFGLSKKYLDITTGVHIP 174
            |||::|.|::.|:||||::..::||:||:|||:|.....|:  :::|||||:|:|:|..|..|||
 Frog   140 TVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHIIHIIDFGLAKEYIDPETKKHIP 204

  Fly   175 YREERSLTGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEK 239
            |||.:||||||||.||..|.|.|.:||||:.|:|::.|||.|||||||.|||.|.:::|::|.:.
 Frog   205 YREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDT 269

  Fly   240 KISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRML--RNGLNLRPGLIYDW 298
            |.:..:|||||.||.|...||.|.|.:.|::||:||::..:|..|  |.|.:.  ..:|||
 Frog   270 KRNTPVEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRTLFSELFERKGYSF--DYVYDW 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 137/267 (51%)
SPS1 16..>242 CDD:223589 120/228 (53%)
csnk1g1XP_031753667.1 STKc_CK1_gamma 43..331 CDD:271028 144/288 (50%)
CK1gamma_C 331..429 CDD:403712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.