DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and Asator

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster


Alignment Length:289 Identity:97/289 - (33%)
Similarity:155/289 - (53%) Gaps:17/289 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYFHK 81
            :|||||||.|.||:||.|..:.:.|:||:||||::.....|..|..:.:.|:....:.|.....:
  Fly   173 WKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGR 237

  Fly    82 EEHYQAMVMDLLGPSLERLFQFCER-AFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMG 145
            .:.:..:||.|.|.:|..|.:...| ||::.|.|.|..|:|:.:|.:|:.|||||||||.||.:|
  Fly   238 NDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVG 302

  Fly   146 -LGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGY 209
             |....::||::||||:::|...|..|..| |......||.|||||.||...|..|.||:.::.|
  Fly   303 RLPYNCRRVYMLDFGLARQYTTGTGEVRCP-RAAAGFRGTVRYASINAHRNREMGRHDDLWSLFY 366

  Fly   210 VLMYFNRGSLPWQDLK----ASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYD 270
            :|:.|..|.|||:.:|    ....::||:.          .:|.:..|.:...:|.:.:.:.:.|
  Fly   367 MLVEFVNGQLPWRKIKDKEQVGLTKEKYDH----------RILLKHLPSDLKQFLEHIQSLTYGD 421

  Fly   271 KPNYDFICRMFRMLRNGLNLRPGLIYDWD 299
            :|:|..:..:|........::....|||:
  Fly   422 RPDYAMLIGLFERCMKRRGVKESDPYDWE 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 93/269 (35%)
SPS1 16..>242 CDD:223589 87/230 (38%)
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 93/270 (34%)
S_TKc 173..414 CDD:214567 90/251 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452733
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.