DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2577 and ball

DIOPT Version :9

Sequence 1:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster


Alignment Length:373 Identity:104/373 - (27%)
Similarity:154/373 - (41%) Gaps:79/373 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GNYKVVRKIGCGSFGDIYLGIYIHSGER---VAIKVESSKVRHPQLN----YERRIYRALRPA-- 70
            |.:::...||.|.||:||....:  ||:   ..:|.|      |..|    .|...|  ||.|  
  Fly    45 GQWRIGPSIGVGGFGEIYAACKV--GEKNYDAVVKCE------PHGNGPLFVEMHFY--LRNAKL 99

  Fly    71 ---------HGLPRIRYFH---------KEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLA 117
                     |||..:...:         ..|.::.:||...|..|.:..:...:.....||..||
  Fly   100 EDIKQFMQKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLA 164

  Fly   118 EQMLRRVEYVHNRGFLHRDIKPDNFLMGL---GTMSKQVYLIDFGLSKKYLDITTGVHIPYREER 179
            .|||...:|:|:.|::|.|:|..|.|:||   |  :.|.||:||||:..::   ||...| ..::
  Fly   165 IQMLDVYQYMHSNGYVHADLKAANILLGLEKGG--AAQAYLVDFGLASHFV---TGDFKP-DPKK 223

  Fly   180 SLTGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPW--QDLKA-STKQQKYERIHEKKI 241
            ...||..|.|..||.||.: ||.|:..:||.|:.:....|||  |.|.| ..|.||.:......|
  Fly   224 MHNGTIEYTSRDAHLGVPT-RRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNI 287

  Fly   242 SVSIEVLC-EGFPCEFTMYLNYCRGMGFYDKPNYDFICR--------MFRMLRNGLNLRPGLIYD 297
            ..|::.|. :|.|.....::.|...:....:|:|| .||        ..::..||         |
  Fly   288 GESLKTLFPKGVPPPIGDFMKYVSKLTHNQEPDYD-KCRSWFSSALKQLKIPNNG---------D 342

  Fly   298 WDMLMMKFHNTQKN---PGIGMRVFPPKQKEDDGISGEPIIK---DEK 339
            .|..|....::..|   ||........|.|:.|    .|::.   |||
  Fly   343 LDFKMKPQTSSNNNLSPPGTSKAATARKAKKID----SPVLNSSLDEK 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 88/306 (29%)
SPS1 16..>242 CDD:223589 77/258 (30%)
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 89/300 (30%)
SPS1 47..432 CDD:223589 103/371 (28%)
Pol_alpha_B_N <399..>502 CDD:285602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452729
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.